Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ICY3

Protein Details
Accession A0A165ICY3   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-122KNPNKGGKKEKAPAEKKKPGRPKKKAASEEEDEBasic
NLS Segment(s)
PositionSequence
11-28RAPRAAKASKPAGEKKTR
92-115PNKGGKKEKAPAEKKKPGRPKKKA
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKAESETKTRAPRAAKASKPAGEKKTRAPSAYALFVKEQMPIWKENNPEKKHTEAMKEEQMPIWKENNPEKKHTEAMKEIAALWADSDKNPNKGGKKEKAPAEKKKPGRPKKKAASEEEDEGDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.57
4 0.57
5 0.61
6 0.61
7 0.64
8 0.64
9 0.63
10 0.62
11 0.61
12 0.62
13 0.65
14 0.64
15 0.58
16 0.52
17 0.49
18 0.45
19 0.48
20 0.4
21 0.31
22 0.28
23 0.29
24 0.26
25 0.22
26 0.2
27 0.17
28 0.18
29 0.19
30 0.21
31 0.23
32 0.27
33 0.35
34 0.43
35 0.42
36 0.45
37 0.45
38 0.47
39 0.48
40 0.46
41 0.43
42 0.38
43 0.39
44 0.4
45 0.38
46 0.35
47 0.31
48 0.31
49 0.28
50 0.25
51 0.23
52 0.19
53 0.23
54 0.31
55 0.39
56 0.39
57 0.42
58 0.44
59 0.45
60 0.48
61 0.46
62 0.42
63 0.36
64 0.35
65 0.31
66 0.28
67 0.25
68 0.2
69 0.17
70 0.13
71 0.1
72 0.09
73 0.09
74 0.09
75 0.15
76 0.17
77 0.2
78 0.23
79 0.28
80 0.31
81 0.39
82 0.48
83 0.5
84 0.56
85 0.6
86 0.66
87 0.72
88 0.76
89 0.79
90 0.8
91 0.81
92 0.81
93 0.84
94 0.87
95 0.87
96 0.89
97 0.88
98 0.89
99 0.9
100 0.92
101 0.9
102 0.87
103 0.85
104 0.79
105 0.74
106 0.66