Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BCX9

Protein Details
Accession A0A165BCX9    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AKTRRACSKAPPKSKAPPKPKPAPPPPKPTIHydrophilic
NLS Segment(s)
PositionSequence
9-29SKAPPKSKAPPKPKPAPPPPK
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MAKTRRACSKAPPKSKAPPKPKPAPPPPKPTIEAWMSDVVLPELFAAAASHPIPDEPVLEPTGPASGKTPFAFQHPSYSDGCAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.82
4 0.81
5 0.81
6 0.8
7 0.84
8 0.86
9 0.86
10 0.86
11 0.87
12 0.84
13 0.84
14 0.78
15 0.73
16 0.67
17 0.58
18 0.52
19 0.43
20 0.36
21 0.29
22 0.27
23 0.21
24 0.19
25 0.17
26 0.12
27 0.1
28 0.08
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.08
43 0.07
44 0.09
45 0.11
46 0.11
47 0.11
48 0.1
49 0.13
50 0.12
51 0.11
52 0.11
53 0.12
54 0.16
55 0.17
56 0.19
57 0.17
58 0.22
59 0.28
60 0.27
61 0.34
62 0.33
63 0.35
64 0.34