Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E638

Protein Details
Accession A0A165E638   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
83-107GDLVMLSTKHRRRNYKKGGKKRVAKBasic
NLS Segment(s)
PositionSequence
91-107KHRRRNYKKGGKKRVAK
Subcellular Location(s) mito 14, nucl 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MNTVNASTGFSGFQLKTGRSPRIIPPLLPLPADATQAEVDAHAIIQRLETDVKEAQDNLLAAKVRQAYHANEHRAPEDVYKVGDLVMLSTKHRRRNYKKGGKKRVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.27
4 0.33
5 0.36
6 0.34
7 0.38
8 0.39
9 0.46
10 0.47
11 0.4
12 0.39
13 0.4
14 0.39
15 0.36
16 0.3
17 0.23
18 0.23
19 0.24
20 0.18
21 0.14
22 0.13
23 0.13
24 0.13
25 0.08
26 0.08
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.09
38 0.1
39 0.11
40 0.11
41 0.11
42 0.1
43 0.1
44 0.1
45 0.08
46 0.09
47 0.08
48 0.08
49 0.11
50 0.13
51 0.12
52 0.16
53 0.18
54 0.18
55 0.27
56 0.34
57 0.37
58 0.36
59 0.38
60 0.35
61 0.35
62 0.33
63 0.26
64 0.22
65 0.18
66 0.16
67 0.15
68 0.14
69 0.12
70 0.12
71 0.1
72 0.08
73 0.11
74 0.12
75 0.14
76 0.23
77 0.3
78 0.38
79 0.46
80 0.56
81 0.62
82 0.72
83 0.81
84 0.83
85 0.88
86 0.91
87 0.94