Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZCV1

Protein Details
Accession A0A165ZCV1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
35-57SAGAGWRGRRRRRASRVGMRDGYHydrophilic
NLS Segment(s)
PositionSequence
38-51AGWRGRRRRRASRV
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MPPVHTPRAGLHLTAGGCTPSPAKPGHATHLGRLSAGAGWRGRRRRRASRVGMRDGYHDGGGDEGGPQRKGRMRGQREAQGQEAMPGNIRPAHPPSNPALRRDLRTSHWTWQPLVQAAALPTHTPVSSLHKDLQVSVQEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.14
4 0.13
5 0.13
6 0.14
7 0.11
8 0.14
9 0.15
10 0.18
11 0.24
12 0.26
13 0.31
14 0.38
15 0.38
16 0.38
17 0.44
18 0.4
19 0.33
20 0.31
21 0.26
22 0.18
23 0.18
24 0.18
25 0.13
26 0.19
27 0.26
28 0.35
29 0.42
30 0.5
31 0.58
32 0.65
33 0.72
34 0.77
35 0.8
36 0.82
37 0.83
38 0.8
39 0.76
40 0.65
41 0.58
42 0.51
43 0.41
44 0.31
45 0.22
46 0.15
47 0.11
48 0.1
49 0.08
50 0.05
51 0.07
52 0.08
53 0.09
54 0.09
55 0.11
56 0.15
57 0.19
58 0.26
59 0.34
60 0.38
61 0.45
62 0.5
63 0.55
64 0.55
65 0.53
66 0.47
67 0.39
68 0.33
69 0.28
70 0.24
71 0.17
72 0.13
73 0.11
74 0.11
75 0.12
76 0.12
77 0.13
78 0.17
79 0.22
80 0.22
81 0.25
82 0.28
83 0.36
84 0.38
85 0.38
86 0.41
87 0.39
88 0.43
89 0.44
90 0.44
91 0.39
92 0.43
93 0.45
94 0.44
95 0.46
96 0.45
97 0.42
98 0.42
99 0.4
100 0.35
101 0.32
102 0.25
103 0.2
104 0.19
105 0.19
106 0.16
107 0.12
108 0.11
109 0.12
110 0.12
111 0.11
112 0.13
113 0.2
114 0.24
115 0.27
116 0.3
117 0.32
118 0.33
119 0.34
120 0.38