Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165L243

Protein Details
Accession A0A165L243    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-44EEEVKDKLKKRRDRELGEEGDAcidic
NLS Segment(s)
PositionSequence
267-275PGASKKRKA
291-296VKKVKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008851  TFIIF-alpha  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Amino Acid Sequences MAAGGRRLKMVDKGAQSLFGDDDEEEVKDKLKKRRDRELGEEGDLDEIEFEDDFADDDEKMNVDGEDDDEEAKELEERIKRETRAANKLRQAGVDEDESEEEDFLKDLTGAGKDVKKALRTFEKNAAYDSDDDKNPYLTSEDEEEEEVPPTPQATGPDASSTAPPAKSGSKPSQKDKGTSKPHTNGKSRPSSRATSPTAPGTGSSLLAHRATSPKGKGANGSASRASSPKMSGGSGRPMSPTHPGAPRAASPLANGSGSRATSPAAPGASKKRKAEDLSSPAPGGSGQPAVKKVKKTAPSGAAPPPGRQIDEALVVEWLRVQSKPPTTMECISKFRAYLVDKNAKIILTNIIKKVAELKGGVLTLKPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.4
4 0.35
5 0.29
6 0.22
7 0.19
8 0.14
9 0.15
10 0.12
11 0.13
12 0.13
13 0.12
14 0.16
15 0.21
16 0.28
17 0.35
18 0.45
19 0.54
20 0.6
21 0.71
22 0.78
23 0.79
24 0.81
25 0.81
26 0.76
27 0.69
28 0.62
29 0.51
30 0.42
31 0.34
32 0.25
33 0.15
34 0.1
35 0.08
36 0.06
37 0.06
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.13
63 0.17
64 0.19
65 0.25
66 0.31
67 0.32
68 0.38
69 0.45
70 0.47
71 0.54
72 0.59
73 0.6
74 0.61
75 0.66
76 0.61
77 0.54
78 0.48
79 0.4
80 0.36
81 0.29
82 0.23
83 0.18
84 0.17
85 0.17
86 0.15
87 0.12
88 0.09
89 0.08
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.07
97 0.07
98 0.11
99 0.13
100 0.14
101 0.18
102 0.21
103 0.24
104 0.24
105 0.3
106 0.36
107 0.39
108 0.43
109 0.48
110 0.5
111 0.46
112 0.46
113 0.42
114 0.34
115 0.31
116 0.29
117 0.24
118 0.19
119 0.2
120 0.2
121 0.19
122 0.17
123 0.15
124 0.13
125 0.1
126 0.11
127 0.12
128 0.13
129 0.12
130 0.13
131 0.13
132 0.12
133 0.12
134 0.11
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.08
141 0.1
142 0.11
143 0.11
144 0.12
145 0.12
146 0.12
147 0.12
148 0.12
149 0.12
150 0.11
151 0.11
152 0.12
153 0.14
154 0.16
155 0.21
156 0.29
157 0.35
158 0.39
159 0.45
160 0.52
161 0.5
162 0.53
163 0.54
164 0.55
165 0.55
166 0.57
167 0.58
168 0.57
169 0.62
170 0.64
171 0.63
172 0.59
173 0.56
174 0.61
175 0.56
176 0.55
177 0.52
178 0.48
179 0.46
180 0.47
181 0.45
182 0.38
183 0.37
184 0.33
185 0.29
186 0.26
187 0.23
188 0.18
189 0.14
190 0.11
191 0.1
192 0.09
193 0.1
194 0.1
195 0.1
196 0.09
197 0.11
198 0.13
199 0.17
200 0.17
201 0.2
202 0.22
203 0.23
204 0.24
205 0.24
206 0.31
207 0.28
208 0.29
209 0.26
210 0.24
211 0.24
212 0.23
213 0.21
214 0.14
215 0.13
216 0.13
217 0.13
218 0.13
219 0.15
220 0.17
221 0.23
222 0.23
223 0.23
224 0.22
225 0.21
226 0.23
227 0.25
228 0.25
229 0.22
230 0.25
231 0.26
232 0.26
233 0.27
234 0.27
235 0.26
236 0.25
237 0.21
238 0.17
239 0.18
240 0.18
241 0.16
242 0.15
243 0.13
244 0.13
245 0.13
246 0.13
247 0.11
248 0.1
249 0.11
250 0.12
251 0.12
252 0.11
253 0.11
254 0.15
255 0.25
256 0.34
257 0.39
258 0.41
259 0.43
260 0.49
261 0.53
262 0.55
263 0.54
264 0.53
265 0.5
266 0.5
267 0.45
268 0.38
269 0.34
270 0.28
271 0.2
272 0.14
273 0.14
274 0.13
275 0.16
276 0.22
277 0.29
278 0.34
279 0.37
280 0.41
281 0.46
282 0.51
283 0.54
284 0.57
285 0.57
286 0.56
287 0.57
288 0.57
289 0.57
290 0.51
291 0.47
292 0.45
293 0.4
294 0.37
295 0.33
296 0.29
297 0.23
298 0.26
299 0.25
300 0.19
301 0.18
302 0.16
303 0.16
304 0.14
305 0.13
306 0.1
307 0.1
308 0.13
309 0.19
310 0.25
311 0.3
312 0.32
313 0.36
314 0.41
315 0.46
316 0.5
317 0.49
318 0.48
319 0.48
320 0.47
321 0.42
322 0.38
323 0.4
324 0.37
325 0.39
326 0.43
327 0.49
328 0.47
329 0.5
330 0.5
331 0.43
332 0.38
333 0.32
334 0.31
335 0.3
336 0.36
337 0.35
338 0.37
339 0.37
340 0.37
341 0.42
342 0.37
343 0.32
344 0.27
345 0.27
346 0.26
347 0.27
348 0.27
349 0.21