Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DIX9

Protein Details
Accession A0A165DIX9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71DRHEPLPKRERRHRSNMPRASABasic
NLS Segment(s)
PositionSequence
56-64PKRERRHRS
Subcellular Location(s) extr 11, plas 9, mito 4, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKFSLISVLGLVALSFASPVSLGSDSVRVSRTAHAIPAPMPLTNSRNWADRHEPLPKRERRHRSNMPRASAPASFMRDVARRSTQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.06
8 0.07
9 0.07
10 0.08
11 0.11
12 0.11
13 0.13
14 0.14
15 0.12
16 0.13
17 0.14
18 0.17
19 0.15
20 0.16
21 0.15
22 0.15
23 0.14
24 0.16
25 0.15
26 0.12
27 0.12
28 0.13
29 0.15
30 0.15
31 0.18
32 0.16
33 0.2
34 0.21
35 0.25
36 0.28
37 0.29
38 0.32
39 0.38
40 0.4
41 0.42
42 0.51
43 0.53
44 0.57
45 0.64
46 0.7
47 0.68
48 0.75
49 0.8
50 0.81
51 0.85
52 0.85
53 0.8
54 0.73
55 0.68
56 0.62
57 0.52
58 0.44
59 0.38
60 0.35
61 0.3
62 0.27
63 0.28
64 0.29
65 0.3
66 0.33
67 0.37