Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165BK40

Protein Details
Accession A0A165BK40    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-30QGLVNLRRKTSRPRPRPRPTIKNCPTKLSHydrophilic
NLS Segment(s)
PositionSequence
9-19RKTSRPRPRPR
Subcellular Location(s) nucl 17.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MQGLVNLRRKTSRPRPRPRPTIKNCPTKLSLGSTHGASTTPVLGLTTSQVLPKLMHTFSIGKCTPATRSRKTCITRPTPISSSPPARLGPPPPSLLSMSTRRPPVSRPVPPSSIRQLSSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.87
4 0.94
5 0.93
6 0.93
7 0.91
8 0.92
9 0.89
10 0.89
11 0.81
12 0.76
13 0.68
14 0.6
15 0.54
16 0.47
17 0.41
18 0.34
19 0.33
20 0.27
21 0.25
22 0.22
23 0.19
24 0.14
25 0.12
26 0.09
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.1
40 0.13
41 0.11
42 0.11
43 0.13
44 0.16
45 0.15
46 0.22
47 0.2
48 0.18
49 0.18
50 0.18
51 0.21
52 0.25
53 0.32
54 0.32
55 0.38
56 0.41
57 0.49
58 0.52
59 0.54
60 0.56
61 0.56
62 0.56
63 0.56
64 0.57
65 0.51
66 0.5
67 0.48
68 0.45
69 0.42
70 0.37
71 0.36
72 0.3
73 0.3
74 0.31
75 0.31
76 0.31
77 0.3
78 0.3
79 0.28
80 0.29
81 0.29
82 0.27
83 0.28
84 0.28
85 0.31
86 0.34
87 0.37
88 0.37
89 0.37
90 0.38
91 0.43
92 0.48
93 0.51
94 0.53
95 0.56
96 0.6
97 0.61
98 0.64
99 0.63
100 0.6
101 0.53