Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ESU7

Protein Details
Accession A0A165ESU7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-79TVNALTRLIHHRRRRPRRQPRDVRPTBasic
NLS Segment(s)
PositionSequence
61-77LIHHRRRRPRRQPRDVR
Subcellular Location(s) plas 13, extr 6, E.R. 3, mito 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKWMVGESASRTVPPWTVLVVDDIHVLVHLVLVVLASAVLAVHAVRVKPSKPRTVNALTRLIHHRRRRPRRQPRDVRPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.12
4 0.13
5 0.13
6 0.13
7 0.12
8 0.11
9 0.1
10 0.09
11 0.08
12 0.07
13 0.07
14 0.05
15 0.04
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.04
32 0.06
33 0.09
34 0.1
35 0.19
36 0.24
37 0.33
38 0.36
39 0.38
40 0.44
41 0.5
42 0.56
43 0.52
44 0.55
45 0.46
46 0.47
47 0.53
48 0.54
49 0.55
50 0.58
51 0.63
52 0.66
53 0.77
54 0.84
55 0.88
56 0.91
57 0.93
58 0.95
59 0.96