Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165H9I3

Protein Details
Accession A0A165H9I3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-150SSSSSAPPSKRKTRKSKSRSPTKKTPTRRRRQAVESHydrophilic
NLS Segment(s)
PositionSequence
122-145PSKRKTRKSKSRSPTKKTPTRRRR
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020796  ORC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0000808  C:origin recognition complex  
GO:0006260  P:DNA replication  
Amino Acid Sequences MWPPKATLEALDIAHPGRSSIVRALCALFADRDIAPPFLYLHDAFCPRRTHVMLTDVLRSVNARTAVVDARSCISQRAFFSAVLRQLTSGDLELEKSWTDSVDAFCAGLRDVLGSSSSSAPPSKRKTRKSKSRSPTKKTPTRRRRQAVESDSESDDAMNVDSDNAMPLGPVVLAIDSAEHLRDHLADLLVPLTRLHELARIDITVVFVSSNSWIDVQPPFAAAPDPYMIHVPPLDKESMIATLSLPYAGPPALLSLFRQFIASLYATCSAFIRDPDELAYIAAVTWPPVAARIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.14
4 0.13
5 0.13
6 0.15
7 0.2
8 0.22
9 0.22
10 0.23
11 0.24
12 0.22
13 0.22
14 0.21
15 0.15
16 0.13
17 0.14
18 0.13
19 0.16
20 0.17
21 0.17
22 0.15
23 0.16
24 0.16
25 0.14
26 0.18
27 0.15
28 0.15
29 0.19
30 0.24
31 0.25
32 0.3
33 0.32
34 0.31
35 0.38
36 0.38
37 0.37
38 0.35
39 0.38
40 0.38
41 0.36
42 0.37
43 0.31
44 0.29
45 0.25
46 0.22
47 0.18
48 0.18
49 0.16
50 0.13
51 0.13
52 0.15
53 0.17
54 0.18
55 0.18
56 0.14
57 0.15
58 0.16
59 0.16
60 0.16
61 0.15
62 0.17
63 0.18
64 0.22
65 0.23
66 0.22
67 0.24
68 0.25
69 0.27
70 0.25
71 0.24
72 0.18
73 0.17
74 0.17
75 0.16
76 0.12
77 0.09
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.08
85 0.07
86 0.08
87 0.08
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.09
94 0.08
95 0.07
96 0.06
97 0.05
98 0.05
99 0.05
100 0.06
101 0.05
102 0.07
103 0.08
104 0.08
105 0.09
106 0.11
107 0.13
108 0.2
109 0.28
110 0.37
111 0.44
112 0.54
113 0.64
114 0.73
115 0.82
116 0.83
117 0.86
118 0.86
119 0.89
120 0.89
121 0.86
122 0.86
123 0.85
124 0.85
125 0.86
126 0.87
127 0.86
128 0.87
129 0.89
130 0.85
131 0.82
132 0.79
133 0.78
134 0.71
135 0.66
136 0.58
137 0.5
138 0.44
139 0.38
140 0.31
141 0.21
142 0.16
143 0.11
144 0.08
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.06
171 0.07
172 0.07
173 0.06
174 0.07
175 0.08
176 0.07
177 0.07
178 0.06
179 0.06
180 0.07
181 0.07
182 0.07
183 0.11
184 0.11
185 0.12
186 0.13
187 0.12
188 0.12
189 0.12
190 0.13
191 0.09
192 0.08
193 0.07
194 0.06
195 0.06
196 0.07
197 0.07
198 0.07
199 0.08
200 0.08
201 0.1
202 0.11
203 0.12
204 0.11
205 0.11
206 0.1
207 0.1
208 0.11
209 0.09
210 0.1
211 0.1
212 0.11
213 0.11
214 0.12
215 0.12
216 0.12
217 0.14
218 0.13
219 0.12
220 0.15
221 0.15
222 0.13
223 0.14
224 0.14
225 0.14
226 0.13
227 0.12
228 0.1
229 0.1
230 0.1
231 0.1
232 0.09
233 0.07
234 0.08
235 0.08
236 0.07
237 0.06
238 0.08
239 0.09
240 0.1
241 0.12
242 0.14
243 0.16
244 0.16
245 0.16
246 0.15
247 0.14
248 0.17
249 0.16
250 0.13
251 0.14
252 0.17
253 0.16
254 0.17
255 0.17
256 0.16
257 0.17
258 0.18
259 0.19
260 0.17
261 0.18
262 0.19
263 0.2
264 0.18
265 0.16
266 0.15
267 0.1
268 0.09
269 0.09
270 0.08
271 0.07
272 0.07
273 0.07
274 0.07