Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165ZEE5

Protein Details
Accession A0A165ZEE5   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-53VPVCDRRACGKREKKRLRQRGRKLREKRRRPTPDENEKHTBasic
NLS Segment(s)
PositionSequence
23-55GKREKKRLRQRGRKLREKRRRPTPDENEKHTKK
Subcellular Location(s) mito 14, cyto 7, nucl 6
Family & Domain DBs
Amino Acid Sequences MRVSTAPWARRGSVPVCDRRACGKREKKRLRQRGRKLREKRRRPTPDENEKHTKKEGNGREAGGHAQDVPVAAASRLVARDLLRGPGAVGHGLLAMRCGADAAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.49
4 0.49
5 0.48
6 0.53
7 0.56
8 0.51
9 0.54
10 0.57
11 0.61
12 0.7
13 0.79
14 0.81
15 0.85
16 0.92
17 0.93
18 0.93
19 0.94
20 0.94
21 0.93
22 0.93
23 0.93
24 0.93
25 0.92
26 0.92
27 0.9
28 0.9
29 0.9
30 0.87
31 0.88
32 0.87
33 0.87
34 0.82
35 0.8
36 0.78
37 0.71
38 0.65
39 0.56
40 0.49
41 0.4
42 0.43
43 0.42
44 0.38
45 0.38
46 0.36
47 0.35
48 0.32
49 0.31
50 0.22
51 0.16
52 0.1
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.12
68 0.13
69 0.15
70 0.15
71 0.14
72 0.14
73 0.14
74 0.15
75 0.11
76 0.1
77 0.08
78 0.09
79 0.09
80 0.08
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06