Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166B4P1

Protein Details
Accession A0A166B4P1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-105ASLVTFQASRKKKKKTSHLQVCPFMGHydrophilic
NLS Segment(s)
PositionSequence
89-94RKKKKK
Subcellular Location(s) mito 10, nucl 9, cyto_nucl 7, cyto 3, pero 3
Family & Domain DBs
Amino Acid Sequences MGSPCIMLFLGEVSNTLADIAHPVRYLKAVRYLSTTFGEAELLLAFSSSGPKLETLRSPGLIFLTRRDRRLFDLCVRQSASLVTFQASRKKKKKTSHLQVCPFMGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.09
7 0.09
8 0.1
9 0.11
10 0.12
11 0.12
12 0.16
13 0.17
14 0.16
15 0.23
16 0.24
17 0.24
18 0.29
19 0.29
20 0.29
21 0.29
22 0.27
23 0.19
24 0.17
25 0.16
26 0.11
27 0.1
28 0.07
29 0.06
30 0.04
31 0.04
32 0.04
33 0.03
34 0.05
35 0.04
36 0.05
37 0.05
38 0.06
39 0.07
40 0.09
41 0.1
42 0.14
43 0.15
44 0.16
45 0.16
46 0.15
47 0.16
48 0.17
49 0.16
50 0.16
51 0.26
52 0.27
53 0.3
54 0.32
55 0.33
56 0.35
57 0.4
58 0.41
59 0.37
60 0.45
61 0.43
62 0.45
63 0.45
64 0.4
65 0.35
66 0.31
67 0.25
68 0.17
69 0.16
70 0.13
71 0.15
72 0.17
73 0.26
74 0.33
75 0.42
76 0.49
77 0.59
78 0.67
79 0.73
80 0.82
81 0.84
82 0.88
83 0.89
84 0.91
85 0.89
86 0.87