Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EDM2

Protein Details
Accession A0A165EDM2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-84NAGSPDARRRERRRCRHREYTTRLATRBasic
NLS Segment(s)
PositionSequence
67-67R
69-69R
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
Amino Acid Sequences MRPTLRYRASIALVLRMRFPVDSRSGLRLAARDGREYSCRVEPAKDARNVSYAVQRTNAGSPDARRRERRRCRHREYTTRLATRLPRTRPVHPLADVLADASPTMKTAPKANAKPTTRCITLMFLRKLIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.28
4 0.26
5 0.22
6 0.23
7 0.2
8 0.21
9 0.25
10 0.26
11 0.29
12 0.29
13 0.29
14 0.29
15 0.25
16 0.25
17 0.27
18 0.25
19 0.24
20 0.26
21 0.27
22 0.29
23 0.29
24 0.29
25 0.25
26 0.27
27 0.25
28 0.25
29 0.26
30 0.31
31 0.37
32 0.37
33 0.35
34 0.34
35 0.35
36 0.34
37 0.31
38 0.29
39 0.24
40 0.2
41 0.2
42 0.19
43 0.18
44 0.19
45 0.18
46 0.13
47 0.13
48 0.15
49 0.23
50 0.3
51 0.34
52 0.41
53 0.48
54 0.57
55 0.67
56 0.75
57 0.77
58 0.8
59 0.85
60 0.87
61 0.89
62 0.88
63 0.86
64 0.85
65 0.82
66 0.74
67 0.66
68 0.59
69 0.55
70 0.53
71 0.53
72 0.47
73 0.48
74 0.5
75 0.54
76 0.57
77 0.56
78 0.51
79 0.45
80 0.42
81 0.34
82 0.3
83 0.25
84 0.19
85 0.14
86 0.1
87 0.08
88 0.07
89 0.06
90 0.06
91 0.07
92 0.09
93 0.1
94 0.15
95 0.24
96 0.33
97 0.38
98 0.46
99 0.55
100 0.57
101 0.62
102 0.64
103 0.63
104 0.55
105 0.52
106 0.46
107 0.43
108 0.46
109 0.49
110 0.45
111 0.4