Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GL78

Protein Details
Accession A0A165GL78    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-24VVTYSCTVRHRRRRGSSSHGASHydrophilic
NLS Segment(s)
PositionSequence
13-17RRRRG
29-34RHAPKR
Subcellular Location(s) mito 19, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTVVTYSCTVRHRRRRGSSSHGASHTTPRHAPKRFTAASRPTRPTLRASNLIIARPRTRRSERRSATPCAVARSSTLGVDVAPARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.82
4 0.81
5 0.81
6 0.77
7 0.74
8 0.65
9 0.58
10 0.53
11 0.53
12 0.47
13 0.41
14 0.38
15 0.38
16 0.44
17 0.46
18 0.48
19 0.44
20 0.5
21 0.48
22 0.47
23 0.48
24 0.49
25 0.53
26 0.57
27 0.55
28 0.5
29 0.5
30 0.48
31 0.45
32 0.41
33 0.37
34 0.34
35 0.32
36 0.35
37 0.34
38 0.35
39 0.33
40 0.3
41 0.31
42 0.32
43 0.34
44 0.37
45 0.44
46 0.51
47 0.57
48 0.65
49 0.64
50 0.69
51 0.71
52 0.7
53 0.65
54 0.63
55 0.57
56 0.52
57 0.48
58 0.38
59 0.34
60 0.32
61 0.29
62 0.21
63 0.2
64 0.15
65 0.13
66 0.16