Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165JYD8

Protein Details
Accession A0A165JYD8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MCHKDSANSRRRQTRHRTITLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MCHKDSANSRRRQTRHRTITLSLPHRLRSLGPSTTASTLDVPARPVQTPTVLGAVHWQGLGWALLYKPVPAALTLSTTIGRCTGFSKLSACTVPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.79
4 0.76
5 0.69
6 0.71
7 0.7
8 0.65
9 0.6
10 0.52
11 0.46
12 0.42
13 0.4
14 0.33
15 0.28
16 0.28
17 0.23
18 0.23
19 0.23
20 0.24
21 0.25
22 0.24
23 0.2
24 0.15
25 0.15
26 0.14
27 0.12
28 0.12
29 0.13
30 0.14
31 0.13
32 0.13
33 0.13
34 0.12
35 0.12
36 0.11
37 0.11
38 0.1
39 0.09
40 0.1
41 0.1
42 0.1
43 0.09
44 0.08
45 0.06
46 0.07
47 0.07
48 0.05
49 0.05
50 0.04
51 0.07
52 0.07
53 0.08
54 0.07
55 0.08
56 0.08
57 0.08
58 0.1
59 0.08
60 0.1
61 0.11
62 0.12
63 0.13
64 0.13
65 0.13
66 0.13
67 0.13
68 0.11
69 0.13
70 0.16
71 0.16
72 0.17
73 0.19
74 0.2
75 0.24