Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165F6F2

Protein Details
Accession A0A165F6F2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-85RVPVKRPTTPVKRPTPVKRPTPVKRPVPHydrophilic
NLS Segment(s)
PositionSequence
44-100RKAPVQTRPKAAKPRVPVKRPTTPVKRPTPVKRPTPVKRPVPVKPPVKKPPVKTPPK
Subcellular Location(s) extr 24, plas 1, E.R. 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR045564  DUF5910  
Pfam View protein in Pfam  
PF19287  DUF5910  
Amino Acid Sequences MTAFSRLVVLAVLYLSLLTSAIPVVQNATLTDLDTSDIAARAVRKAPVQTRPKAAKPRVPVKRPTTPVKRPTPVKRPTPVKRPVPVKPPVKKPPVKTPPKTSTPVKTPPKTTTPTTGQACPMPSKAPTKSKPRALFDALTGHYFVKRSPVFLGWHGTNSNTWNVWHRAGYLKKPWSWLDIIRQSKSGRSGADQELGEGVYLTDQRETAEAFANINSGRNSGTTPVICAIFALNERDWVTLPKVWLPDNLIGDSSDQRKHEQYEAYRLQWIQRVFPTIHPSGVIRFAPLDRGRGSPPSQFVIPSSLTNRVYAECTPVGHIPPGAPRGNINFTQWKHAWHIFDDTCTPGSSSRGPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.06
9 0.07
10 0.07
11 0.09
12 0.1
13 0.11
14 0.11
15 0.14
16 0.12
17 0.13
18 0.13
19 0.11
20 0.11
21 0.1
22 0.11
23 0.09
24 0.09
25 0.09
26 0.1
27 0.11
28 0.14
29 0.17
30 0.19
31 0.21
32 0.28
33 0.34
34 0.42
35 0.5
36 0.52
37 0.59
38 0.64
39 0.69
40 0.73
41 0.74
42 0.71
43 0.72
44 0.77
45 0.77
46 0.77
47 0.78
48 0.75
49 0.78
50 0.77
51 0.77
52 0.77
53 0.77
54 0.79
55 0.79
56 0.8
57 0.79
58 0.82
59 0.82
60 0.81
61 0.79
62 0.79
63 0.8
64 0.81
65 0.81
66 0.81
67 0.79
68 0.79
69 0.77
70 0.75
71 0.73
72 0.74
73 0.73
74 0.72
75 0.74
76 0.75
77 0.78
78 0.78
79 0.75
80 0.77
81 0.78
82 0.8
83 0.77
84 0.78
85 0.75
86 0.75
87 0.75
88 0.69
89 0.66
90 0.63
91 0.66
92 0.66
93 0.63
94 0.61
95 0.61
96 0.62
97 0.59
98 0.54
99 0.51
100 0.47
101 0.49
102 0.47
103 0.44
104 0.39
105 0.37
106 0.36
107 0.31
108 0.27
109 0.21
110 0.21
111 0.24
112 0.28
113 0.35
114 0.39
115 0.48
116 0.54
117 0.61
118 0.65
119 0.64
120 0.64
121 0.59
122 0.54
123 0.45
124 0.43
125 0.35
126 0.29
127 0.25
128 0.19
129 0.16
130 0.15
131 0.14
132 0.16
133 0.15
134 0.16
135 0.17
136 0.19
137 0.2
138 0.22
139 0.26
140 0.18
141 0.2
142 0.19
143 0.18
144 0.16
145 0.15
146 0.15
147 0.12
148 0.12
149 0.15
150 0.17
151 0.17
152 0.16
153 0.16
154 0.21
155 0.23
156 0.27
157 0.3
158 0.32
159 0.32
160 0.35
161 0.35
162 0.31
163 0.3
164 0.28
165 0.28
166 0.32
167 0.35
168 0.33
169 0.35
170 0.33
171 0.33
172 0.33
173 0.28
174 0.2
175 0.18
176 0.22
177 0.21
178 0.24
179 0.22
180 0.19
181 0.17
182 0.16
183 0.14
184 0.09
185 0.07
186 0.04
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.06
193 0.07
194 0.07
195 0.09
196 0.09
197 0.09
198 0.09
199 0.1
200 0.1
201 0.11
202 0.1
203 0.08
204 0.08
205 0.09
206 0.09
207 0.1
208 0.12
209 0.11
210 0.11
211 0.12
212 0.12
213 0.11
214 0.11
215 0.09
216 0.08
217 0.09
218 0.11
219 0.1
220 0.12
221 0.13
222 0.13
223 0.14
224 0.15
225 0.16
226 0.15
227 0.16
228 0.17
229 0.18
230 0.19
231 0.2
232 0.21
233 0.23
234 0.23
235 0.22
236 0.19
237 0.18
238 0.19
239 0.21
240 0.21
241 0.2
242 0.19
243 0.22
244 0.24
245 0.27
246 0.3
247 0.33
248 0.33
249 0.4
250 0.43
251 0.42
252 0.42
253 0.4
254 0.38
255 0.36
256 0.34
257 0.28
258 0.25
259 0.28
260 0.26
261 0.3
262 0.33
263 0.3
264 0.29
265 0.26
266 0.25
267 0.23
268 0.26
269 0.22
270 0.16
271 0.16
272 0.16
273 0.24
274 0.24
275 0.26
276 0.23
277 0.26
278 0.28
279 0.31
280 0.34
281 0.31
282 0.33
283 0.32
284 0.31
285 0.29
286 0.28
287 0.27
288 0.25
289 0.24
290 0.24
291 0.27
292 0.27
293 0.28
294 0.28
295 0.25
296 0.26
297 0.24
298 0.26
299 0.2
300 0.21
301 0.22
302 0.23
303 0.24
304 0.22
305 0.22
306 0.18
307 0.23
308 0.28
309 0.27
310 0.25
311 0.26
312 0.31
313 0.36
314 0.36
315 0.36
316 0.39
317 0.38
318 0.46
319 0.44
320 0.42
321 0.44
322 0.47
323 0.44
324 0.38
325 0.45
326 0.38
327 0.4
328 0.39
329 0.35
330 0.31
331 0.29
332 0.27
333 0.2
334 0.23