Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E256

Protein Details
Accession A0A165E256    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
123-144GIVACLHRHRRRRARVRAADTSHydrophilic
NLS Segment(s)
PositionSequence
132-137RRRRAR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 7.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSTAQDASTTATTTMSVTRSTSSRSQRASEDSAIRPPSSSASISSTTVNADILADETATQMQEEQTITPTDTTTPNTSVTSSSISVLSLPTSNEPTPRAASGRNIAIYIAISLACVLVFCGCGIVACLHRHRRRRARVRAADTSIRPYAPEPTEEAQPERTQDDTGSNTTSKERPLQLEYPFDNPRKAHGLIHDVREPQSATSLRSLSELGTAVEQAGFSVEAVVASLRSVAQQSDAHHPPTYNAEGHAGVSTVVVQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.14
4 0.14
5 0.16
6 0.17
7 0.22
8 0.29
9 0.35
10 0.41
11 0.44
12 0.46
13 0.48
14 0.52
15 0.53
16 0.5
17 0.48
18 0.43
19 0.46
20 0.46
21 0.42
22 0.36
23 0.31
24 0.28
25 0.25
26 0.23
27 0.18
28 0.2
29 0.22
30 0.22
31 0.22
32 0.2
33 0.17
34 0.17
35 0.15
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.06
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.08
51 0.08
52 0.1
53 0.11
54 0.11
55 0.11
56 0.11
57 0.11
58 0.13
59 0.15
60 0.17
61 0.17
62 0.18
63 0.18
64 0.19
65 0.18
66 0.17
67 0.17
68 0.14
69 0.14
70 0.12
71 0.11
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.09
78 0.12
79 0.13
80 0.14
81 0.15
82 0.17
83 0.18
84 0.18
85 0.18
86 0.16
87 0.18
88 0.19
89 0.2
90 0.18
91 0.17
92 0.15
93 0.14
94 0.12
95 0.1
96 0.07
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.05
112 0.07
113 0.09
114 0.14
115 0.23
116 0.3
117 0.38
118 0.47
119 0.56
120 0.64
121 0.73
122 0.79
123 0.81
124 0.84
125 0.83
126 0.8
127 0.74
128 0.68
129 0.59
130 0.52
131 0.42
132 0.33
133 0.27
134 0.21
135 0.22
136 0.18
137 0.18
138 0.17
139 0.18
140 0.21
141 0.21
142 0.22
143 0.2
144 0.19
145 0.2
146 0.17
147 0.16
148 0.14
149 0.13
150 0.15
151 0.15
152 0.16
153 0.17
154 0.16
155 0.16
156 0.18
157 0.19
158 0.19
159 0.21
160 0.22
161 0.23
162 0.28
163 0.32
164 0.32
165 0.37
166 0.36
167 0.37
168 0.41
169 0.39
170 0.38
171 0.33
172 0.34
173 0.33
174 0.32
175 0.29
176 0.27
177 0.34
178 0.34
179 0.38
180 0.39
181 0.35
182 0.35
183 0.34
184 0.31
185 0.22
186 0.25
187 0.22
188 0.2
189 0.22
190 0.22
191 0.2
192 0.2
193 0.2
194 0.15
195 0.15
196 0.14
197 0.1
198 0.1
199 0.1
200 0.09
201 0.09
202 0.08
203 0.06
204 0.06
205 0.06
206 0.05
207 0.06
208 0.05
209 0.05
210 0.05
211 0.06
212 0.05
213 0.05
214 0.05
215 0.05
216 0.06
217 0.07
218 0.07
219 0.11
220 0.14
221 0.17
222 0.25
223 0.29
224 0.31
225 0.32
226 0.32
227 0.3
228 0.34
229 0.35
230 0.28
231 0.25
232 0.26
233 0.24
234 0.25
235 0.23
236 0.17
237 0.13
238 0.12