Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DTZ8

Protein Details
Accession A0A165DTZ8    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
30-56TPVDNAATKRHRRRARKSKKVDTWIPEHydrophilic
NLS Segment(s)
PositionSequence
38-50KRHRRRARKSKKV
85-94SRRRRAARKT
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSMSSSSSPISASSPALESSPADPAPSSATPVDNAATKRHRRRARKSKKVDTWIPERNRYHKHTEGDREHRRIVDSYRPDAESGSRRRRAARKTKMADSWVAERDRDHDDRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.13
6 0.13
7 0.16
8 0.14
9 0.13
10 0.13
11 0.13
12 0.17
13 0.16
14 0.18
15 0.14
16 0.15
17 0.15
18 0.16
19 0.16
20 0.15
21 0.16
22 0.19
23 0.27
24 0.35
25 0.43
26 0.52
27 0.6
28 0.67
29 0.77
30 0.82
31 0.85
32 0.88
33 0.89
34 0.9
35 0.9
36 0.88
37 0.83
38 0.76
39 0.73
40 0.71
41 0.65
42 0.63
43 0.56
44 0.55
45 0.55
46 0.54
47 0.53
48 0.5
49 0.51
50 0.49
51 0.56
52 0.57
53 0.62
54 0.65
55 0.62
56 0.57
57 0.53
58 0.48
59 0.41
60 0.37
61 0.36
62 0.33
63 0.33
64 0.34
65 0.34
66 0.32
67 0.3
68 0.31
69 0.31
70 0.35
71 0.41
72 0.44
73 0.45
74 0.53
75 0.6
76 0.66
77 0.69
78 0.71
79 0.72
80 0.73
81 0.78
82 0.76
83 0.72
84 0.66
85 0.59
86 0.54
87 0.49
88 0.44
89 0.37
90 0.32
91 0.32
92 0.35
93 0.37
94 0.38