Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J4UR15

Protein Details
Accession J4UR15    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPPLHSRRPRPQDFDRQRWDRBasic
NLS Segment(s)
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, mito 7, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
Pfam View protein in Pfam  
PF13637  Ank_4  
Amino Acid Sequences MPPPLHSRRPRPQDFDRQRWDRLHKLPRTAKTAFLFAVYDDDGPKLRELVAAGTPTSTSATPYSALRSGALKALLERVADSNGCGLDKKATALHHPGGPVYVNNGPERHFHETGIRMLLDHGASVLERDTESNTPLHYAAFGSNVRCFRLLASKLPRDADASIVNLKRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.79
5 0.77
6 0.77
7 0.75
8 0.73
9 0.72
10 0.72
11 0.68
12 0.73
13 0.75
14 0.73
15 0.72
16 0.65
17 0.62
18 0.54
19 0.51
20 0.4
21 0.33
22 0.27
23 0.2
24 0.21
25 0.15
26 0.14
27 0.11
28 0.12
29 0.12
30 0.12
31 0.12
32 0.1
33 0.09
34 0.1
35 0.1
36 0.11
37 0.12
38 0.12
39 0.12
40 0.11
41 0.11
42 0.11
43 0.11
44 0.09
45 0.08
46 0.08
47 0.09
48 0.1
49 0.11
50 0.13
51 0.13
52 0.13
53 0.12
54 0.13
55 0.12
56 0.13
57 0.13
58 0.1
59 0.09
60 0.11
61 0.11
62 0.1
63 0.09
64 0.09
65 0.09
66 0.09
67 0.09
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.08
76 0.09
77 0.1
78 0.12
79 0.16
80 0.18
81 0.17
82 0.17
83 0.16
84 0.15
85 0.14
86 0.12
87 0.11
88 0.12
89 0.13
90 0.14
91 0.15
92 0.15
93 0.17
94 0.23
95 0.27
96 0.25
97 0.24
98 0.27
99 0.29
100 0.29
101 0.29
102 0.23
103 0.16
104 0.16
105 0.17
106 0.12
107 0.09
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.06
116 0.09
117 0.1
118 0.12
119 0.12
120 0.13
121 0.14
122 0.14
123 0.13
124 0.11
125 0.1
126 0.1
127 0.13
128 0.14
129 0.15
130 0.2
131 0.21
132 0.23
133 0.22
134 0.22
135 0.2
136 0.28
137 0.29
138 0.33
139 0.41
140 0.45
141 0.48
142 0.5
143 0.49
144 0.42
145 0.4
146 0.35
147 0.28
148 0.26
149 0.29