Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165J9T4

Protein Details
Accession A0A165J9T4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
236-276GSMGYKARAKRSKAGKKMRKGKGKGKGKKSKKTPKADRAALBasic
NLS Segment(s)
PositionSequence
34-75RRKGLRIGGGGRPASRPPSRAPIIRPKPTIISKKPHPTIIKK
241-274KARAKRSKAGKKMRKGKGKGKGKKSKKTPKADRA
Subcellular Location(s) extr 22, mito 3
Family & Domain DBs
Amino Acid Sequences MQRLGLLFFFSTLFLAVFLQAAPLDGESEGTLVRRKGLRIGGGGRPASRPPSRAPIIRPKPTIISKKPHPTIIKKPHSETTIKKSTSHTESHSSTTPPSSQSATTPPLSQSHSTTSAPAASHTTTPPGGTLTGTGSASHSATRTSDPEATDTDLPNLPSVPTKTKKGLHWPTGVSGEPLGGGLWRNLPGVSLSFDPSGTGWCRKIKVNIGAPGTGGIYGGGYGGGYGDTSGYPSDGSMGYKARAKRSKAGKKMRKGKGKGKGKKSKKTPKADRAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.06
8 0.07
9 0.07
10 0.07
11 0.07
12 0.07
13 0.08
14 0.07
15 0.08
16 0.08
17 0.09
18 0.12
19 0.12
20 0.16
21 0.18
22 0.19
23 0.25
24 0.29
25 0.31
26 0.33
27 0.38
28 0.38
29 0.42
30 0.43
31 0.38
32 0.36
33 0.35
34 0.37
35 0.35
36 0.32
37 0.3
38 0.38
39 0.41
40 0.44
41 0.48
42 0.52
43 0.59
44 0.64
45 0.62
46 0.56
47 0.58
48 0.61
49 0.64
50 0.6
51 0.59
52 0.6
53 0.68
54 0.68
55 0.69
56 0.68
57 0.66
58 0.7
59 0.72
60 0.73
61 0.67
62 0.68
63 0.66
64 0.63
65 0.61
66 0.56
67 0.53
68 0.53
69 0.49
70 0.47
71 0.45
72 0.47
73 0.46
74 0.44
75 0.39
76 0.35
77 0.36
78 0.38
79 0.36
80 0.31
81 0.27
82 0.26
83 0.24
84 0.19
85 0.19
86 0.17
87 0.16
88 0.17
89 0.2
90 0.21
91 0.2
92 0.2
93 0.19
94 0.2
95 0.23
96 0.22
97 0.2
98 0.2
99 0.23
100 0.22
101 0.21
102 0.19
103 0.18
104 0.17
105 0.16
106 0.14
107 0.11
108 0.12
109 0.12
110 0.13
111 0.11
112 0.11
113 0.11
114 0.09
115 0.08
116 0.07
117 0.08
118 0.06
119 0.08
120 0.08
121 0.08
122 0.07
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.07
129 0.09
130 0.09
131 0.11
132 0.13
133 0.13
134 0.14
135 0.15
136 0.16
137 0.17
138 0.16
139 0.15
140 0.14
141 0.14
142 0.12
143 0.12
144 0.1
145 0.11
146 0.13
147 0.18
148 0.2
149 0.23
150 0.28
151 0.33
152 0.36
153 0.44
154 0.5
155 0.49
156 0.5
157 0.47
158 0.45
159 0.43
160 0.39
161 0.29
162 0.21
163 0.15
164 0.1
165 0.09
166 0.07
167 0.05
168 0.05
169 0.05
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.09
177 0.1
178 0.1
179 0.11
180 0.11
181 0.11
182 0.11
183 0.11
184 0.13
185 0.14
186 0.16
187 0.18
188 0.21
189 0.24
190 0.27
191 0.32
192 0.37
193 0.43
194 0.47
195 0.49
196 0.48
197 0.46
198 0.43
199 0.38
200 0.3
201 0.22
202 0.14
203 0.08
204 0.05
205 0.05
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.08
222 0.08
223 0.09
224 0.11
225 0.13
226 0.15
227 0.21
228 0.25
229 0.33
230 0.4
231 0.44
232 0.5
233 0.59
234 0.68
235 0.73
236 0.81
237 0.81
238 0.84
239 0.9
240 0.91
241 0.91
242 0.89
243 0.88
244 0.87
245 0.89
246 0.88
247 0.88
248 0.89
249 0.89
250 0.91
251 0.92
252 0.93
253 0.92
254 0.93
255 0.93
256 0.93