Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165G3N3

Protein Details
Accession A0A165G3N3   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
97-127LARLHRLAARRHRCRPTCRSFRHRARRRSHSBasic
NLS Segment(s)
PositionSequence
89-126RRMSRLRALARLHRLAARRHRCRPTCRSFRHRARRRSH
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MQYFGPAPLEGFSAQEQYMPPQGLSRYIALPTDAPTAQPAYPTIHHHHHPGMVIPSYQHPNQVPGHGLNCLWPVCNPSHSGPTTPRTARRMSRLRALARLHRLAARRHRCRPTCRSFRHRARRRSHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.15
5 0.19
6 0.18
7 0.17
8 0.18
9 0.19
10 0.2
11 0.22
12 0.2
13 0.17
14 0.17
15 0.17
16 0.15
17 0.15
18 0.15
19 0.16
20 0.14
21 0.13
22 0.14
23 0.16
24 0.15
25 0.15
26 0.14
27 0.14
28 0.16
29 0.2
30 0.24
31 0.26
32 0.27
33 0.29
34 0.29
35 0.27
36 0.26
37 0.23
38 0.21
39 0.17
40 0.16
41 0.13
42 0.15
43 0.17
44 0.17
45 0.18
46 0.15
47 0.18
48 0.19
49 0.19
50 0.18
51 0.15
52 0.16
53 0.13
54 0.13
55 0.1
56 0.12
57 0.11
58 0.09
59 0.09
60 0.1
61 0.11
62 0.12
63 0.14
64 0.14
65 0.2
66 0.2
67 0.22
68 0.24
69 0.26
70 0.32
71 0.32
72 0.36
73 0.35
74 0.4
75 0.42
76 0.48
77 0.53
78 0.5
79 0.55
80 0.57
81 0.56
82 0.58
83 0.58
84 0.57
85 0.55
86 0.54
87 0.48
88 0.45
89 0.46
90 0.48
91 0.54
92 0.56
93 0.58
94 0.65
95 0.73
96 0.77
97 0.82
98 0.84
99 0.84
100 0.84
101 0.85
102 0.85
103 0.86
104 0.89
105 0.91
106 0.91
107 0.9