Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PBI0

Protein Details
Accession A0A165PBI0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-58GDLSWARRRHRLRRRLRFPPFTCTHydrophilic
NLS Segment(s)
PositionSequence
40-51ARRRHRLRRRLR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MTHIIICKITSPLPSRPPSPLLEYLFSESSKRPGGDLSWARRRHRLRRRLRFPPFTCTPEKRHTFLYIPVPRSNAVAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.42
4 0.44
5 0.41
6 0.42
7 0.41
8 0.36
9 0.35
10 0.34
11 0.33
12 0.31
13 0.28
14 0.24
15 0.19
16 0.19
17 0.19
18 0.18
19 0.15
20 0.14
21 0.14
22 0.21
23 0.26
24 0.3
25 0.36
26 0.41
27 0.42
28 0.5
29 0.56
30 0.58
31 0.63
32 0.66
33 0.69
34 0.75
35 0.83
36 0.85
37 0.88
38 0.88
39 0.81
40 0.79
41 0.74
42 0.67
43 0.66
44 0.6
45 0.57
46 0.56
47 0.58
48 0.52
49 0.5
50 0.5
51 0.45
52 0.46
53 0.5
54 0.48
55 0.48
56 0.48
57 0.47
58 0.43