Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PA89

Protein Details
Accession A0A165PA89    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
35-57PCDTDVRTRSRRRLRNCRRGLAAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, cyto 6.5, mito 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023591  Ribosomal_S2_flav_dom_sf  
Amino Acid Sequences MRSSKEPILIFINSPSIDHQAIREASYVNILVIAPCDTDVRTRSRRRLRNCRRGLAAAAAVDYVTAPDSWDANGAGTGITAAATCGLDWKTDTGAAGGEWGVEPVPRCRLAASGDRGLGKGAKTCRDALCSSWVIRVRLHESMIRRATTAGVDFLHLCDHSIDRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.2
4 0.2
5 0.19
6 0.18
7 0.21
8 0.22
9 0.22
10 0.21
11 0.18
12 0.17
13 0.19
14 0.18
15 0.11
16 0.11
17 0.09
18 0.08
19 0.08
20 0.08
21 0.06
22 0.07
23 0.08
24 0.08
25 0.11
26 0.13
27 0.2
28 0.29
29 0.36
30 0.45
31 0.55
32 0.63
33 0.71
34 0.8
35 0.84
36 0.86
37 0.86
38 0.83
39 0.77
40 0.71
41 0.62
42 0.53
43 0.44
44 0.33
45 0.25
46 0.18
47 0.13
48 0.1
49 0.08
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.02
68 0.02
69 0.03
70 0.03
71 0.03
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.06
91 0.07
92 0.11
93 0.11
94 0.12
95 0.12
96 0.13
97 0.17
98 0.23
99 0.26
100 0.26
101 0.27
102 0.27
103 0.27
104 0.26
105 0.24
106 0.18
107 0.18
108 0.19
109 0.21
110 0.23
111 0.27
112 0.28
113 0.31
114 0.32
115 0.29
116 0.31
117 0.29
118 0.28
119 0.3
120 0.33
121 0.3
122 0.3
123 0.32
124 0.31
125 0.31
126 0.33
127 0.31
128 0.31
129 0.38
130 0.42
131 0.38
132 0.33
133 0.31
134 0.3
135 0.28
136 0.26
137 0.19
138 0.15
139 0.15
140 0.15
141 0.15
142 0.17
143 0.14
144 0.13
145 0.13
146 0.15