Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165P4F9

Protein Details
Accession A0A165P4F9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
43-72ADRLWAQRDRRRRRCSNRCWREHRVSRGGEBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 9, cyto 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSANSKLGYWALSSLTAAISRILGGTLASTSMYLRHLLAFLLADRLWAQRDRRRRRCSNRCWREHRVSRGGEDESESDEDEDEAHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.08
6 0.07
7 0.07
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.07
33 0.09
34 0.12
35 0.16
36 0.21
37 0.32
38 0.43
39 0.53
40 0.62
41 0.71
42 0.79
43 0.85
44 0.9
45 0.91
46 0.91
47 0.9
48 0.9
49 0.88
50 0.88
51 0.86
52 0.83
53 0.8
54 0.72
55 0.66
56 0.62
57 0.55
58 0.45
59 0.38
60 0.3
61 0.26
62 0.24
63 0.21
64 0.17
65 0.16
66 0.15