Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E7R7

Protein Details
Accession A0A165E7R7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
126-146GVTVAFQKRRRTSKLRPPTCVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR040648  HMGXB3_CxC4  
Pfam View protein in Pfam  
PF18717  CxC4  
Amino Acid Sequences KACTVFDVDRAYSARVDVRACSDPTCQRSAGPDLGDIGVFNLNNFTLVTHALFSKYDSQFSNSETTFHAFIASMRDEYQTYQSPHAFMSEDLFRTCWFSFMNLQTCSDSFKCTECGDHPDVVIADGVTVAFQKRRRTSKLRPPTCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.21
4 0.19
5 0.22
6 0.25
7 0.26
8 0.27
9 0.29
10 0.34
11 0.37
12 0.38
13 0.33
14 0.3
15 0.33
16 0.35
17 0.33
18 0.27
19 0.23
20 0.21
21 0.21
22 0.2
23 0.15
24 0.12
25 0.1
26 0.09
27 0.08
28 0.07
29 0.07
30 0.07
31 0.07
32 0.06
33 0.05
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.08
40 0.1
41 0.17
42 0.16
43 0.18
44 0.18
45 0.21
46 0.21
47 0.23
48 0.25
49 0.17
50 0.18
51 0.17
52 0.17
53 0.15
54 0.14
55 0.12
56 0.08
57 0.09
58 0.11
59 0.1
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.14
66 0.15
67 0.16
68 0.19
69 0.19
70 0.19
71 0.18
72 0.18
73 0.16
74 0.11
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.12
81 0.15
82 0.15
83 0.13
84 0.11
85 0.13
86 0.17
87 0.22
88 0.27
89 0.24
90 0.26
91 0.26
92 0.26
93 0.29
94 0.24
95 0.22
96 0.17
97 0.18
98 0.19
99 0.19
100 0.21
101 0.19
102 0.26
103 0.27
104 0.27
105 0.25
106 0.24
107 0.24
108 0.21
109 0.19
110 0.11
111 0.08
112 0.07
113 0.07
114 0.05
115 0.05
116 0.07
117 0.12
118 0.17
119 0.26
120 0.35
121 0.43
122 0.52
123 0.61
124 0.7
125 0.76
126 0.83