Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NFK0

Protein Details
Accession A0A165NFK0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-54VVFMRIRRFRRNHQRRHSDFSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 10.5, cyto 6.5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDISTTSVPAMLTINALGWSISTTSVARYAFRVVFMRIRRFRRNHQRRHSDFSFVKLARPSRGAYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.05
6 0.06
7 0.06
8 0.06
9 0.07
10 0.06
11 0.07
12 0.1
13 0.11
14 0.11
15 0.11
16 0.14
17 0.12
18 0.14
19 0.15
20 0.13
21 0.19
22 0.22
23 0.31
24 0.35
25 0.42
26 0.49
27 0.53
28 0.62
29 0.68
30 0.75
31 0.76
32 0.8
33 0.84
34 0.82
35 0.86
36 0.78
37 0.76
38 0.66
39 0.6
40 0.59
41 0.48
42 0.46
43 0.43
44 0.44
45 0.39
46 0.41