Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J4UH92

Protein Details
Accession J4UH92    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-38GCAPAAGAKKQKKKWSKGKVKDKAQHAVHydrophilic
NLS Segment(s)
PositionSequence
17-33GAKKQKKKWSKGKVKDK
Subcellular Location(s) mito 17, cyto 7, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MWANQALQKIGCAPAAGAKKQKKKWSKGKVKDKAQHAVILDKSTADKLYKDVQSYRLVTVAVLVDRMKINGSLARKCISDLEEKGMIKPVTTHSKMKIYTRAIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.25
4 0.32
5 0.39
6 0.48
7 0.56
8 0.66
9 0.69
10 0.74
11 0.81
12 0.83
13 0.86
14 0.87
15 0.91
16 0.91
17 0.92
18 0.88
19 0.84
20 0.79
21 0.7
22 0.62
23 0.52
24 0.46
25 0.37
26 0.31
27 0.25
28 0.18
29 0.16
30 0.14
31 0.14
32 0.1
33 0.09
34 0.1
35 0.16
36 0.17
37 0.19
38 0.19
39 0.22
40 0.25
41 0.26
42 0.24
43 0.19
44 0.17
45 0.15
46 0.15
47 0.12
48 0.08
49 0.07
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.08
57 0.11
58 0.15
59 0.17
60 0.19
61 0.21
62 0.2
63 0.21
64 0.22
65 0.21
66 0.24
67 0.23
68 0.26
69 0.3
70 0.3
71 0.3
72 0.34
73 0.31
74 0.25
75 0.25
76 0.26
77 0.31
78 0.35
79 0.38
80 0.36
81 0.44
82 0.48
83 0.52
84 0.54
85 0.49