Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DVL4

Protein Details
Accession A0A165DVL4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-42VSVRRLRRLHLRRLRLCRLRBasic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 8, extr 2, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MSPSQCLNVSVSISVSVSVSVSVSVRRLRRLHLRRLRLCRLRVCLRLYVPTSVSMSTSSSLSLFAVSAVSVVSVVSVSVSVSVSVSVSVSVSDVHLVPYVAPAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.08
4 0.07
5 0.07
6 0.06
7 0.06
8 0.06
9 0.07
10 0.1
11 0.16
12 0.18
13 0.25
14 0.26
15 0.31
16 0.41
17 0.48
18 0.56
19 0.6
20 0.68
21 0.7
22 0.77
23 0.81
24 0.78
25 0.76
26 0.71
27 0.69
28 0.65
29 0.62
30 0.56
31 0.5
32 0.44
33 0.43
34 0.38
35 0.32
36 0.26
37 0.22
38 0.2
39 0.16
40 0.15
41 0.11
42 0.1
43 0.09
44 0.09
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.07
81 0.08
82 0.09
83 0.09
84 0.09