Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165HW23

Protein Details
Accession A0A165HW23    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-70PSCFVFPHFPTRRQRKKPRRARTARHGAMVHydrophilic
NLS Segment(s)
PositionSequence
52-65RRQRKKPRRARTAR
Subcellular Location(s) mito 7, extr 7, plas 5, mito_nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MPVSSRVWARCLDLGLVRSLALWASVLSRSVGRCASSLSLPSCFVFPHFPTRRQRKKPRRARTARHGAMVARVCLSVRARPFFVPWPSSVPRTATVNARGSDTCALRDMPLAGGPDALPNPDDYTSSEEFIPGLPTRQLKFTHRMVEQRWFEAYKEDIVRAYSDWDFKDMMLVSTIVVRQSLPPIPPPEPSKALVLDIFLDNLPPDMRDSILAELSIGSGRQHAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.23
4 0.19
5 0.16
6 0.15
7 0.12
8 0.09
9 0.07
10 0.06
11 0.07
12 0.08
13 0.09
14 0.09
15 0.12
16 0.12
17 0.15
18 0.16
19 0.16
20 0.15
21 0.17
22 0.19
23 0.18
24 0.21
25 0.2
26 0.21
27 0.21
28 0.21
29 0.19
30 0.17
31 0.17
32 0.18
33 0.18
34 0.27
35 0.31
36 0.39
37 0.48
38 0.59
39 0.69
40 0.74
41 0.84
42 0.84
43 0.9
44 0.93
45 0.94
46 0.94
47 0.94
48 0.93
49 0.92
50 0.92
51 0.84
52 0.76
53 0.67
54 0.56
55 0.52
56 0.44
57 0.33
58 0.23
59 0.2
60 0.17
61 0.18
62 0.19
63 0.17
64 0.18
65 0.2
66 0.21
67 0.22
68 0.24
69 0.27
70 0.29
71 0.27
72 0.24
73 0.28
74 0.29
75 0.3
76 0.29
77 0.25
78 0.23
79 0.24
80 0.25
81 0.22
82 0.25
83 0.28
84 0.27
85 0.26
86 0.25
87 0.23
88 0.24
89 0.21
90 0.16
91 0.13
92 0.13
93 0.11
94 0.12
95 0.1
96 0.07
97 0.09
98 0.09
99 0.07
100 0.07
101 0.07
102 0.08
103 0.07
104 0.07
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.08
111 0.13
112 0.14
113 0.15
114 0.14
115 0.13
116 0.13
117 0.12
118 0.14
119 0.09
120 0.09
121 0.1
122 0.13
123 0.14
124 0.18
125 0.2
126 0.22
127 0.27
128 0.31
129 0.35
130 0.35
131 0.4
132 0.39
133 0.46
134 0.43
135 0.4
136 0.38
137 0.32
138 0.29
139 0.27
140 0.25
141 0.21
142 0.2
143 0.19
144 0.17
145 0.17
146 0.17
147 0.15
148 0.17
149 0.14
150 0.16
151 0.16
152 0.17
153 0.16
154 0.15
155 0.18
156 0.15
157 0.14
158 0.12
159 0.11
160 0.1
161 0.11
162 0.12
163 0.09
164 0.09
165 0.09
166 0.08
167 0.13
168 0.16
169 0.16
170 0.21
171 0.26
172 0.27
173 0.32
174 0.35
175 0.37
176 0.37
177 0.38
178 0.35
179 0.31
180 0.32
181 0.27
182 0.23
183 0.2
184 0.17
185 0.16
186 0.13
187 0.12
188 0.1
189 0.11
190 0.1
191 0.09
192 0.11
193 0.11
194 0.11
195 0.13
196 0.15
197 0.16
198 0.17
199 0.16
200 0.14
201 0.13
202 0.13
203 0.12
204 0.1
205 0.08