Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DNV1

Protein Details
Accession A0A165DNV1   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-47SAAPADAKPKAKKPKKPPAPPIGQQLTHydrophilic
NLS Segment(s)
PositionSequence
27-39AKPKAKKPKKPPA
Subcellular Location(s) extr 16, nucl 5, mito 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
IPR013766  Thioredoxin_domain  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS51352  THIOREDOXIN_2  
CDD cd02961  PDI_a_family  
Amino Acid Sequences MKFFSLPIGIWAISLLVSSASAAPADAKPKAKKPKKPPAPPIGQQLTLGDFNSTIEHDFWFVEFYSPSCPHCKKFAPTWKEFTESQKDVPKLHFAQVNCLAQGDLCNAQGVKGYPELNFFRDGARLGQFDDERLIPKMTTWLKDQMDKANAPASSSSSTTSTTTTSSSSEAAAPSPTESPAQPALVDQAKDEVKQYEQIVHEHENDDHSHDHDEEEVEQPVLRSNVNPTGSVLSLDPKTFNGAIAEGPIFIKFFAPWC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.04
4 0.04
5 0.05
6 0.06
7 0.06
8 0.06
9 0.06
10 0.08
11 0.1
12 0.14
13 0.18
14 0.25
15 0.31
16 0.4
17 0.51
18 0.59
19 0.67
20 0.74
21 0.81
22 0.85
23 0.9
24 0.91
25 0.9
26 0.9
27 0.85
28 0.84
29 0.77
30 0.67
31 0.57
32 0.48
33 0.41
34 0.32
35 0.27
36 0.18
37 0.13
38 0.12
39 0.12
40 0.12
41 0.1
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.1
52 0.15
53 0.16
54 0.18
55 0.25
56 0.27
57 0.29
58 0.35
59 0.4
60 0.38
61 0.47
62 0.55
63 0.56
64 0.58
65 0.62
66 0.58
67 0.56
68 0.53
69 0.49
70 0.48
71 0.41
72 0.4
73 0.41
74 0.4
75 0.38
76 0.38
77 0.38
78 0.31
79 0.32
80 0.32
81 0.25
82 0.3
83 0.35
84 0.34
85 0.27
86 0.25
87 0.22
88 0.18
89 0.18
90 0.13
91 0.08
92 0.07
93 0.08
94 0.07
95 0.08
96 0.09
97 0.09
98 0.09
99 0.1
100 0.11
101 0.1
102 0.15
103 0.16
104 0.16
105 0.17
106 0.16
107 0.14
108 0.14
109 0.15
110 0.12
111 0.12
112 0.11
113 0.1
114 0.13
115 0.12
116 0.11
117 0.12
118 0.11
119 0.1
120 0.12
121 0.12
122 0.09
123 0.09
124 0.15
125 0.16
126 0.18
127 0.19
128 0.24
129 0.25
130 0.29
131 0.3
132 0.29
133 0.31
134 0.29
135 0.28
136 0.24
137 0.23
138 0.2
139 0.19
140 0.16
141 0.14
142 0.14
143 0.14
144 0.12
145 0.13
146 0.14
147 0.14
148 0.13
149 0.12
150 0.12
151 0.12
152 0.12
153 0.12
154 0.12
155 0.11
156 0.11
157 0.11
158 0.1
159 0.1
160 0.09
161 0.09
162 0.1
163 0.1
164 0.1
165 0.1
166 0.13
167 0.14
168 0.14
169 0.12
170 0.12
171 0.15
172 0.17
173 0.17
174 0.14
175 0.17
176 0.17
177 0.18
178 0.19
179 0.17
180 0.15
181 0.19
182 0.19
183 0.2
184 0.21
185 0.22
186 0.25
187 0.26
188 0.27
189 0.25
190 0.25
191 0.22
192 0.21
193 0.22
194 0.19
195 0.18
196 0.18
197 0.17
198 0.17
199 0.16
200 0.16
201 0.15
202 0.16
203 0.15
204 0.13
205 0.13
206 0.13
207 0.15
208 0.14
209 0.13
210 0.12
211 0.16
212 0.23
213 0.24
214 0.25
215 0.23
216 0.25
217 0.25
218 0.25
219 0.21
220 0.19
221 0.19
222 0.2
223 0.19
224 0.16
225 0.21
226 0.2
227 0.2
228 0.17
229 0.16
230 0.15
231 0.17
232 0.16
233 0.12
234 0.13
235 0.12
236 0.11
237 0.1
238 0.11