Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165NMV6

Protein Details
Accession A0A165NMV6    Localization Confidence High Confidence Score 22.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-28SEEPLFDPSLKKKKKKKTVAFSEDPLHydrophilic
67-89AMFGDLKKKKKKKEIPLDLPEEGBasic
98-121ELDLSDVKKKKKKKDIPMDLVRIRBasic
NLS Segment(s)
PositionSequence
13-19KKKKKKK
73-79KKKKKKK
105-111KKKKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MASEEPLFDPSLKKKKKKKTVAFSEDPLGAEADPTTPAPPADDEPTVHEQMAAHKQEVEAVADDDAAMFGDLKKKKKKKEIPLDLPEEGTSTVPAGDELDLSDVKKKKKKKDIPMDLVRIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.71
3 0.81
4 0.87
5 0.89
6 0.89
7 0.91
8 0.91
9 0.87
10 0.79
11 0.72
12 0.62
13 0.52
14 0.41
15 0.3
16 0.2
17 0.15
18 0.11
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.1
27 0.11
28 0.13
29 0.14
30 0.14
31 0.18
32 0.22
33 0.22
34 0.2
35 0.18
36 0.16
37 0.19
38 0.25
39 0.21
40 0.17
41 0.17
42 0.17
43 0.18
44 0.18
45 0.15
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.1
58 0.15
59 0.21
60 0.32
61 0.39
62 0.47
63 0.58
64 0.68
65 0.72
66 0.79
67 0.84
68 0.84
69 0.85
70 0.83
71 0.73
72 0.64
73 0.53
74 0.42
75 0.32
76 0.22
77 0.14
78 0.08
79 0.07
80 0.06
81 0.07
82 0.06
83 0.06
84 0.06
85 0.06
86 0.08
87 0.09
88 0.09
89 0.17
90 0.21
91 0.29
92 0.37
93 0.45
94 0.53
95 0.64
96 0.74
97 0.78
98 0.85
99 0.88
100 0.91
101 0.92