Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GFX6

Protein Details
Accession A0A165GFX6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
123-152AADKANVKKAKPKPKPKAAAGGKRKRGAKKBasic
NLS Segment(s)
PositionSequence
126-152KANVKKAKPKPKPKAAAGGKRKRGAKK
Subcellular Location(s) cyto_mito 13.166, mito 13, cyto 12, mito_nucl 8.166, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MWAPKSKSRLTSQRDPCVTNVIQKCAQKTEVDVGLVSSAAGFESSGVAVPASYPALMTNGLGTAIGTVEATPAADGVAALVHPAPPVDAPMTTSSVAVPPATTLAPEATDEQIAEMEAAIKIAADKANVKKAKPKPKPKAAAGGKRKRGAKKDESDDEEEEDEGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.62
4 0.59
5 0.52
6 0.51
7 0.46
8 0.41
9 0.43
10 0.43
11 0.44
12 0.41
13 0.42
14 0.33
15 0.32
16 0.32
17 0.28
18 0.26
19 0.23
20 0.19
21 0.17
22 0.16
23 0.13
24 0.07
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.05
76 0.06
77 0.08
78 0.1
79 0.1
80 0.1
81 0.09
82 0.09
83 0.1
84 0.08
85 0.07
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.05
110 0.06
111 0.07
112 0.12
113 0.16
114 0.26
115 0.29
116 0.3
117 0.38
118 0.47
119 0.57
120 0.63
121 0.7
122 0.72
123 0.8
124 0.87
125 0.83
126 0.84
127 0.83
128 0.83
129 0.83
130 0.83
131 0.81
132 0.8
133 0.82
134 0.8
135 0.78
136 0.77
137 0.76
138 0.76
139 0.76
140 0.78
141 0.77
142 0.74
143 0.67
144 0.61
145 0.52