Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165F2W3

Protein Details
Accession A0A165F2W3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31EASPKSALTKNPCHRRRRRRRPTPLHNGFLCHydrophilic
NLS Segment(s)
PositionSequence
15-22RRRRRRRP
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
Amino Acid Sequences EASPKSALTKNPCHRRRRRRRPTPLHNGFLCKGPRQARSRYEGARPHWLARWRDPGPGRVHGRLVAVHHP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.9
4 0.91
5 0.92
6 0.93
7 0.96
8 0.96
9 0.96
10 0.96
11 0.93
12 0.88
13 0.79
14 0.72
15 0.61
16 0.56
17 0.47
18 0.37
19 0.35
20 0.32
21 0.37
22 0.37
23 0.42
24 0.4
25 0.44
26 0.48
27 0.45
28 0.47
29 0.46
30 0.46
31 0.49
32 0.47
33 0.44
34 0.44
35 0.48
36 0.46
37 0.46
38 0.52
39 0.43
40 0.49
41 0.5
42 0.51
43 0.49
44 0.54
45 0.53
46 0.47
47 0.48
48 0.42
49 0.41
50 0.37