Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PMR1

Protein Details
Accession A0A165PMR1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-106GACSRSRRVCWTARRRCRGRGYVLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 8, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MKSFTLVSLLVAAAAAVHAAPFVSKAQTRPSATSPQTVPSSPSLTLKKSTRTTSPSRQSLHSRPSRSARTRGTTLRCSVLKAGACSRSRRVCWTARRRCRGRGYVLSRGYMGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.04
9 0.06
10 0.09
11 0.11
12 0.13
13 0.19
14 0.27
15 0.29
16 0.32
17 0.35
18 0.4
19 0.4
20 0.43
21 0.37
22 0.35
23 0.34
24 0.31
25 0.29
26 0.23
27 0.24
28 0.21
29 0.25
30 0.23
31 0.23
32 0.28
33 0.28
34 0.32
35 0.33
36 0.35
37 0.35
38 0.38
39 0.43
40 0.47
41 0.53
42 0.52
43 0.5
44 0.51
45 0.52
46 0.52
47 0.54
48 0.52
49 0.47
50 0.45
51 0.49
52 0.55
53 0.53
54 0.55
55 0.52
56 0.5
57 0.52
58 0.55
59 0.54
60 0.5
61 0.47
62 0.45
63 0.4
64 0.37
65 0.33
66 0.31
67 0.27
68 0.25
69 0.28
70 0.3
71 0.32
72 0.35
73 0.4
74 0.43
75 0.43
76 0.47
77 0.48
78 0.5
79 0.57
80 0.65
81 0.69
82 0.72
83 0.81
84 0.8
85 0.83
86 0.85
87 0.82
88 0.8
89 0.79
90 0.76
91 0.76
92 0.73
93 0.66
94 0.56