Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165MZY0

Protein Details
Accession A0A165MZY0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-90DCKGTWLEERRNRHRPKPPPKPASABasic
NLS Segment(s)
PositionSequence
75-89RRNRHRPKPPPKPAS
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 9.5, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSPEKPAPSPQDNVKPENYKDMFDGRPVITRFIDPCENAARAAEECMMSTGNREKCLDFFQAYRDCKGTWLEERRNRHRPKPPPKPASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.54
4 0.51
5 0.56
6 0.49
7 0.4
8 0.38
9 0.39
10 0.33
11 0.28
12 0.31
13 0.22
14 0.27
15 0.26
16 0.26
17 0.22
18 0.23
19 0.22
20 0.22
21 0.24
22 0.18
23 0.19
24 0.2
25 0.19
26 0.18
27 0.17
28 0.14
29 0.11
30 0.12
31 0.1
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.08
38 0.14
39 0.15
40 0.17
41 0.18
42 0.18
43 0.19
44 0.23
45 0.24
46 0.19
47 0.18
48 0.22
49 0.29
50 0.3
51 0.31
52 0.29
53 0.27
54 0.27
55 0.29
56 0.27
57 0.29
58 0.36
59 0.44
60 0.5
61 0.6
62 0.68
63 0.76
64 0.79
65 0.8
66 0.81
67 0.82
68 0.85
69 0.87
70 0.89