Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166MA11

Protein Details
Accession A0A166MA11    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPPRKPAQRKRKASSPPPAVERHydrophilic
NLS Segment(s)
PositionSequence
4-21RKPAQRKRKASSPPPAVE
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.833, mito 6.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPPRKPAQRKRKASSPPPAVERTKKIEAAQATSNTTSASKPGITKGSTKKKPAAMTPQPTPQLDNTLAAFKGKFDAYSTALPFINKFYHPSGSSQPDYKATYNAILPWQAKPDYTMRVALDGSSAGRLECRTICNPFDDEPLSPIAIESGKVSSSMKLDAGQTGEPLVFTQSGAGYVASFNFESEDCFDISGTGRFTLRHVWQGDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.82
4 0.78
5 0.77
6 0.74
7 0.71
8 0.68
9 0.64
10 0.6
11 0.56
12 0.51
13 0.5
14 0.46
15 0.43
16 0.42
17 0.37
18 0.35
19 0.32
20 0.31
21 0.26
22 0.24
23 0.19
24 0.15
25 0.15
26 0.13
27 0.14
28 0.18
29 0.22
30 0.22
31 0.3
32 0.38
33 0.47
34 0.52
35 0.56
36 0.58
37 0.6
38 0.62
39 0.61
40 0.61
41 0.6
42 0.6
43 0.59
44 0.59
45 0.57
46 0.53
47 0.49
48 0.39
49 0.34
50 0.29
51 0.26
52 0.2
53 0.18
54 0.18
55 0.17
56 0.16
57 0.11
58 0.12
59 0.1
60 0.1
61 0.09
62 0.12
63 0.14
64 0.17
65 0.17
66 0.17
67 0.18
68 0.18
69 0.16
70 0.16
71 0.15
72 0.13
73 0.15
74 0.15
75 0.18
76 0.18
77 0.21
78 0.23
79 0.26
80 0.27
81 0.26
82 0.25
83 0.25
84 0.27
85 0.25
86 0.21
87 0.17
88 0.16
89 0.15
90 0.15
91 0.12
92 0.12
93 0.13
94 0.12
95 0.14
96 0.13
97 0.13
98 0.14
99 0.16
100 0.16
101 0.16
102 0.18
103 0.15
104 0.16
105 0.16
106 0.14
107 0.12
108 0.09
109 0.08
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.08
116 0.09
117 0.12
118 0.14
119 0.18
120 0.19
121 0.21
122 0.23
123 0.22
124 0.24
125 0.22
126 0.19
127 0.18
128 0.18
129 0.15
130 0.13
131 0.11
132 0.09
133 0.08
134 0.08
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.09
141 0.11
142 0.12
143 0.11
144 0.12
145 0.13
146 0.14
147 0.15
148 0.14
149 0.13
150 0.12
151 0.11
152 0.1
153 0.09
154 0.09
155 0.07
156 0.07
157 0.08
158 0.07
159 0.08
160 0.08
161 0.08
162 0.07
163 0.07
164 0.07
165 0.09
166 0.09
167 0.08
168 0.09
169 0.09
170 0.11
171 0.13
172 0.15
173 0.13
174 0.13
175 0.13
176 0.13
177 0.15
178 0.15
179 0.14
180 0.14
181 0.15
182 0.15
183 0.17
184 0.24
185 0.25
186 0.3