Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165QAU6

Protein Details
Accession A0A165QAU6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-76AAVPAAPPPKPKPKPRPKPIERTAGQHydrophilic
NLS Segment(s)
PositionSequence
40-70PKAKPKPAQPTAAVPAAPPPKPKPKPRPKPI
190-194KGKGK
Subcellular Location(s) cysk 16, nucl 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MASPMDLPPIATLDELPASSPPEQPDELADPEPEPEPPTPKAKPKPAQPTAAVPAAPPPKPKPKPRPKPIERTAGQTLLPLPRVQKIMKADGDLLPVSKEAMHVISVATEEFLKRLAQSSHKLAAAQRRTTVDYKDAATAVQQGDQLQFLHETVPLAVPVSVAFQRREAKAGDIPNGEGSHADSERRAIKGKGKARVNLIVNGKTNGKEPPPPPPMWMGMGTEADAAAMMHMYPPPPHMYPPNGYFPGWGPPPGFPMPPGQPYMRGPPMHPPEWAPYPHMPPPPHMPPHMRPPMPTHRGHPPPRNAPAAASGTSTSASGSGSGATGSRRSSRRISASETAQTNGNGTTNGHAHTNGDAGGGNDSSPSSNGASPEFQSAPGRTIYNPSTLDPRLLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.15
6 0.17
7 0.2
8 0.2
9 0.23
10 0.24
11 0.24
12 0.27
13 0.27
14 0.29
15 0.27
16 0.26
17 0.21
18 0.23
19 0.23
20 0.19
21 0.18
22 0.18
23 0.21
24 0.24
25 0.31
26 0.36
27 0.45
28 0.53
29 0.61
30 0.66
31 0.71
32 0.78
33 0.77
34 0.78
35 0.71
36 0.69
37 0.63
38 0.59
39 0.48
40 0.37
41 0.38
42 0.38
43 0.37
44 0.35
45 0.37
46 0.45
47 0.54
48 0.65
49 0.68
50 0.74
51 0.82
52 0.88
53 0.92
54 0.91
55 0.93
56 0.9
57 0.89
58 0.79
59 0.76
60 0.7
61 0.61
62 0.51
63 0.42
64 0.38
65 0.31
66 0.31
67 0.25
68 0.21
69 0.23
70 0.27
71 0.25
72 0.28
73 0.29
74 0.34
75 0.34
76 0.35
77 0.33
78 0.31
79 0.33
80 0.27
81 0.23
82 0.16
83 0.14
84 0.13
85 0.1
86 0.09
87 0.08
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.1
103 0.13
104 0.18
105 0.22
106 0.27
107 0.3
108 0.3
109 0.31
110 0.31
111 0.38
112 0.39
113 0.37
114 0.35
115 0.34
116 0.37
117 0.38
118 0.37
119 0.31
120 0.26
121 0.26
122 0.24
123 0.22
124 0.17
125 0.16
126 0.17
127 0.14
128 0.13
129 0.13
130 0.12
131 0.12
132 0.13
133 0.13
134 0.09
135 0.09
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.05
146 0.05
147 0.07
148 0.09
149 0.11
150 0.11
151 0.15
152 0.19
153 0.19
154 0.21
155 0.2
156 0.21
157 0.23
158 0.25
159 0.24
160 0.21
161 0.21
162 0.21
163 0.2
164 0.17
165 0.13
166 0.11
167 0.1
168 0.1
169 0.1
170 0.08
171 0.11
172 0.13
173 0.14
174 0.15
175 0.15
176 0.21
177 0.29
178 0.35
179 0.4
180 0.41
181 0.43
182 0.44
183 0.49
184 0.44
185 0.41
186 0.39
187 0.34
188 0.31
189 0.3
190 0.28
191 0.22
192 0.22
193 0.18
194 0.17
195 0.2
196 0.19
197 0.28
198 0.32
199 0.32
200 0.32
201 0.32
202 0.32
203 0.27
204 0.27
205 0.19
206 0.15
207 0.14
208 0.13
209 0.11
210 0.09
211 0.07
212 0.06
213 0.05
214 0.03
215 0.03
216 0.02
217 0.03
218 0.03
219 0.04
220 0.05
221 0.06
222 0.1
223 0.11
224 0.13
225 0.15
226 0.19
227 0.23
228 0.26
229 0.31
230 0.29
231 0.28
232 0.28
233 0.25
234 0.27
235 0.23
236 0.22
237 0.16
238 0.15
239 0.2
240 0.21
241 0.2
242 0.16
243 0.2
244 0.21
245 0.23
246 0.25
247 0.21
248 0.23
249 0.25
250 0.31
251 0.32
252 0.29
253 0.28
254 0.35
255 0.4
256 0.38
257 0.37
258 0.33
259 0.32
260 0.36
261 0.36
262 0.31
263 0.29
264 0.32
265 0.37
266 0.41
267 0.37
268 0.36
269 0.43
270 0.45
271 0.45
272 0.45
273 0.46
274 0.44
275 0.53
276 0.59
277 0.53
278 0.47
279 0.51
280 0.57
281 0.56
282 0.54
283 0.48
284 0.49
285 0.58
286 0.65
287 0.66
288 0.64
289 0.66
290 0.7
291 0.7
292 0.61
293 0.52
294 0.49
295 0.43
296 0.35
297 0.28
298 0.23
299 0.19
300 0.19
301 0.17
302 0.12
303 0.09
304 0.08
305 0.07
306 0.07
307 0.06
308 0.06
309 0.06
310 0.07
311 0.08
312 0.1
313 0.12
314 0.2
315 0.22
316 0.27
317 0.32
318 0.39
319 0.45
320 0.47
321 0.52
322 0.51
323 0.54
324 0.56
325 0.52
326 0.45
327 0.4
328 0.36
329 0.3
330 0.24
331 0.2
332 0.14
333 0.13
334 0.15
335 0.15
336 0.16
337 0.16
338 0.15
339 0.16
340 0.16
341 0.16
342 0.13
343 0.12
344 0.11
345 0.1
346 0.12
347 0.11
348 0.1
349 0.09
350 0.09
351 0.1
352 0.1
353 0.11
354 0.12
355 0.14
356 0.15
357 0.18
358 0.2
359 0.21
360 0.26
361 0.24
362 0.24
363 0.27
364 0.27
365 0.26
366 0.26
367 0.27
368 0.22
369 0.28
370 0.28
371 0.3
372 0.31
373 0.3
374 0.35
375 0.35
376 0.37