Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165DH94

Protein Details
Accession A0A165DH94    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-39LTSSCRSRRRHILRLKRRDISHydrophilic
NLS Segment(s)
PositionSequence
26-40RRRHILRLKRRDISK
Subcellular Location(s) mito 13.5, mito_nucl 12.666, nucl 10.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MFTGKRRYLTPSVNRPNGLTSSCRSRRRHILRLKRRDISKSKWPGYAEGLARHGIGLVDKDGRGWRTRLRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.6
3 0.56
4 0.49
5 0.41
6 0.33
7 0.26
8 0.31
9 0.39
10 0.46
11 0.47
12 0.51
13 0.6
14 0.65
15 0.72
16 0.72
17 0.75
18 0.77
19 0.84
20 0.84
21 0.8
22 0.74
23 0.72
24 0.68
25 0.63
26 0.62
27 0.61
28 0.57
29 0.55
30 0.53
31 0.47
32 0.45
33 0.44
34 0.36
35 0.29
36 0.28
37 0.24
38 0.23
39 0.2
40 0.17
41 0.11
42 0.1
43 0.09
44 0.09
45 0.11
46 0.11
47 0.13
48 0.17
49 0.2
50 0.22
51 0.25
52 0.3