A0A166BNI8

UniProt ID: A0A166BNI8   Organism: Exidia glandulosa HHB12029
Gene: EXIGLDRAFT_759814   Protein: Uncharacterized protein
Length: 119 AA

Protein Details

• Accession: A0A166BNI8
• Localization Confidence: Low
• Confidence Score: 5
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  20-43	LSTYLYKRTRRLRPPPGPHCRPFF	Hydrophilic

• Subcellular Location(s): mito 12, extr 7, plas 5, cyto 1, pero 1, E.R. 1, cyto_pero 1
• Family & Domain DBs:
  • InterPro:
    • IPR036396 Cyt_P450_sf
  • Gene Ontology:
    • GO:0016020 C:membrane
    • GO:0020037 F:heme binding
    • GO:0005506 F:iron ion binding
    • GO:0004497 F:monooxygenase activity
    • GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• Amino Acid Sequences: MTRPRDIVPLVATTVAALLLSTYLYKRTRRLRPPPGPHCRPFFEHAADESHMLMSASGLFAARTDTVSAAMTTFFLVMTLYPEIQSALNGRSIT

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.13
2, 0.09
3, 0.07
4, 0.05
5, 0.03
6, 0.03
7, 0.04
8, 0.05
9, 0.05
10, 0.1
11, 0.14
12, 0.18
13, 0.25
14, 0.35
15, 0.44
16, 0.54
17, 0.64
18, 0.7
19, 0.76
20, 0.84
21, 0.87
22, 0.88
23, 0.86
24, 0.8
25, 0.75
26, 0.67
27, 0.6
28, 0.53
29, 0.46
30, 0.38
31, 0.31
32, 0.28
33, 0.26
34, 0.23
35, 0.19
36, 0.16
37, 0.12
38, 0.1
39, 0.08
40, 0.07
41, 0.04
42, 0.04
43, 0.03
44, 0.03
45, 0.03
46, 0.03
47, 0.03
48, 0.05
49, 0.05
50, 0.06
51, 0.06
52, 0.07
53, 0.08
54, 0.08
55, 0.08
56, 0.07
57, 0.07
58, 0.07
59, 0.07
60, 0.06
61, 0.05
62, 0.05
63, 0.05
64, 0.04
65, 0.07
66, 0.09
67, 0.09
68, 0.09
69, 0.1
70, 0.11
71, 0.11
72, 0.12
73, 0.12
74, 0.12