Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165J0I5

Protein Details
Accession A0A165J0I5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
112-131GLAAHRRRDKKRSTNAKTAPHydrophilic
NLS Segment(s)
PositionSequence
49-56RRREKKRG
117-123RRRDKKR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MIAASSSAKSIASLASVKSLRTFKLDTLRSDLFDAHSVIRTGFAAVTHRRREKKRGANAKTATAPEPIADSPAGLEASSSATSIASSKSLDTFRLDMLSRVGCDAGRTLEAGLAAHRRRDKKRSTNAKTAPAAAAGKLSTLQTKADNPAARRVPAMTSDEMIRSLRLKLHQMRTDLDINASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.18
3 0.19
4 0.19
5 0.24
6 0.26
7 0.24
8 0.28
9 0.29
10 0.27
11 0.36
12 0.4
13 0.38
14 0.43
15 0.43
16 0.39
17 0.39
18 0.34
19 0.27
20 0.24
21 0.23
22 0.17
23 0.17
24 0.16
25 0.15
26 0.14
27 0.13
28 0.11
29 0.1
30 0.09
31 0.13
32 0.19
33 0.27
34 0.34
35 0.42
36 0.49
37 0.54
38 0.63
39 0.68
40 0.71
41 0.75
42 0.78
43 0.76
44 0.78
45 0.75
46 0.7
47 0.63
48 0.55
49 0.45
50 0.36
51 0.29
52 0.19
53 0.19
54 0.15
55 0.13
56 0.1
57 0.09
58 0.07
59 0.08
60 0.08
61 0.06
62 0.05
63 0.04
64 0.06
65 0.07
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.05
73 0.06
74 0.06
75 0.08
76 0.09
77 0.1
78 0.11
79 0.11
80 0.11
81 0.12
82 0.12
83 0.1
84 0.12
85 0.11
86 0.1
87 0.09
88 0.09
89 0.07
90 0.07
91 0.08
92 0.07
93 0.06
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.13
101 0.13
102 0.18
103 0.23
104 0.3
105 0.36
106 0.44
107 0.53
108 0.57
109 0.67
110 0.74
111 0.77
112 0.8
113 0.8
114 0.8
115 0.71
116 0.63
117 0.52
118 0.44
119 0.37
120 0.26
121 0.22
122 0.14
123 0.12
124 0.11
125 0.11
126 0.1
127 0.1
128 0.12
129 0.13
130 0.16
131 0.19
132 0.25
133 0.29
134 0.29
135 0.38
136 0.4
137 0.38
138 0.36
139 0.34
140 0.29
141 0.28
142 0.31
143 0.23
144 0.21
145 0.22
146 0.22
147 0.22
148 0.21
149 0.19
150 0.16
151 0.16
152 0.19
153 0.22
154 0.3
155 0.37
156 0.47
157 0.51
158 0.52
159 0.53
160 0.54
161 0.54
162 0.46