Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165C1H0

Protein Details
Accession A0A165C1H0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-22QYCSRDCQRRHWKADAFCHKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MQYCSRDCQRRHWKADAFCHKTVCAQLKALLPLLDKGEEEFVSAARALLSIEQLAVVYDNVSLGNGDRTLSTAERLRQTEAMLRVQERMAQMSVHDPTDTLHTLRALGFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.81
3 0.81
4 0.77
5 0.7
6 0.65
7 0.56
8 0.51
9 0.49
10 0.44
11 0.35
12 0.3
13 0.3
14 0.31
15 0.32
16 0.31
17 0.26
18 0.2
19 0.19
20 0.19
21 0.16
22 0.13
23 0.12
24 0.12
25 0.11
26 0.11
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.08
57 0.08
58 0.1
59 0.13
60 0.17
61 0.21
62 0.23
63 0.24
64 0.23
65 0.24
66 0.28
67 0.27
68 0.28
69 0.26
70 0.25
71 0.24
72 0.24
73 0.26
74 0.21
75 0.2
76 0.17
77 0.14
78 0.14
79 0.18
80 0.19
81 0.17
82 0.16
83 0.14
84 0.14
85 0.19
86 0.2
87 0.16
88 0.17
89 0.16
90 0.17
91 0.19