Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165N8T5

Protein Details
Accession A0A165N8T5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-61QTGRRPRRRASPYPRSRRAHCBasic
NLS Segment(s)
PositionSequence
42-57TGRRPRRRASPYPRSR
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MHRTRLARTSPLSTLPLKFSPPSSQWHPSASSPSPRRHSLQTGRRPRRRASPYPRSRRAHCCLQAHRTPPMSAASRTTSPSRRTTDSPRRSARPPQPSSLQRRPPKTTSASAMKRRRSTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.33
4 0.3
5 0.29
6 0.28
7 0.31
8 0.3
9 0.34
10 0.36
11 0.4
12 0.39
13 0.4
14 0.4
15 0.36
16 0.4
17 0.38
18 0.41
19 0.41
20 0.47
21 0.49
22 0.49
23 0.51
24 0.49
25 0.54
26 0.54
27 0.58
28 0.61
29 0.67
30 0.74
31 0.78
32 0.78
33 0.73
34 0.73
35 0.72
36 0.71
37 0.7
38 0.71
39 0.74
40 0.8
41 0.86
42 0.8
43 0.77
44 0.75
45 0.7
46 0.68
47 0.64
48 0.61
49 0.57
50 0.59
51 0.59
52 0.53
53 0.52
54 0.44
55 0.38
56 0.32
57 0.3
58 0.26
59 0.22
60 0.22
61 0.21
62 0.21
63 0.23
64 0.27
65 0.29
66 0.3
67 0.36
68 0.38
69 0.39
70 0.42
71 0.5
72 0.57
73 0.6
74 0.65
75 0.65
76 0.65
77 0.66
78 0.72
79 0.71
80 0.71
81 0.66
82 0.63
83 0.65
84 0.69
85 0.74
86 0.74
87 0.74
88 0.72
89 0.76
90 0.78
91 0.72
92 0.71
93 0.68
94 0.63
95 0.6
96 0.62
97 0.63
98 0.67
99 0.72
100 0.74