Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165BND7

Protein Details
Accession A0A165BND7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22AGVPKKRKYKPVAKRVRPVMDTHydrophilic
NLS Segment(s)
PositionSequence
5-15KKRKYKPVAKR
Subcellular Location(s) mito 15.5, mito_nucl 11.333, cyto_nucl 6.333, nucl 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
Amino Acid Sequences AGVPKKRKYKPVAKRVRPVMDTLPPQFRIVRKIPSDPMIGLPTVPTKPPNFVPTAHMTAERMAGFELDKNEFLWPEERKLMAWVLCAHEKVFAWTESERGRFRSDYFPPIKMPVLPHRPWAIKHLPIPPSIRDELLKLLKEKIKAGVYEPSNAAYRSKWFCVVKKDGKSLRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.87
4 0.78
5 0.72
6 0.67
7 0.64
8 0.6
9 0.55
10 0.52
11 0.45
12 0.45
13 0.44
14 0.4
15 0.39
16 0.38
17 0.41
18 0.39
19 0.42
20 0.45
21 0.44
22 0.44
23 0.38
24 0.36
25 0.29
26 0.25
27 0.2
28 0.17
29 0.17
30 0.15
31 0.16
32 0.16
33 0.16
34 0.19
35 0.22
36 0.25
37 0.23
38 0.24
39 0.27
40 0.29
41 0.31
42 0.29
43 0.26
44 0.23
45 0.22
46 0.23
47 0.18
48 0.13
49 0.09
50 0.09
51 0.08
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.11
58 0.11
59 0.12
60 0.14
61 0.14
62 0.15
63 0.16
64 0.16
65 0.16
66 0.17
67 0.17
68 0.13
69 0.13
70 0.12
71 0.13
72 0.14
73 0.14
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.1
80 0.11
81 0.11
82 0.14
83 0.15
84 0.19
85 0.18
86 0.19
87 0.21
88 0.2
89 0.23
90 0.27
91 0.28
92 0.33
93 0.35
94 0.35
95 0.33
96 0.35
97 0.33
98 0.27
99 0.28
100 0.29
101 0.34
102 0.33
103 0.36
104 0.38
105 0.4
106 0.39
107 0.42
108 0.39
109 0.36
110 0.4
111 0.43
112 0.4
113 0.42
114 0.44
115 0.39
116 0.39
117 0.35
118 0.32
119 0.26
120 0.25
121 0.28
122 0.3
123 0.3
124 0.26
125 0.31
126 0.33
127 0.35
128 0.35
129 0.34
130 0.33
131 0.31
132 0.32
133 0.34
134 0.32
135 0.34
136 0.33
137 0.29
138 0.28
139 0.27
140 0.26
141 0.2
142 0.25
143 0.27
144 0.29
145 0.35
146 0.38
147 0.43
148 0.5
149 0.58
150 0.61
151 0.63
152 0.7