Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J5K8I3

Protein Details
Accession J5K8I3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
224-254CIWDDEQRRARERRRRRRRLRVQHRGSWLVNBasic
NLS Segment(s)
PositionSequence
231-244RRARERRRRRRRLR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences MEQEQRLLKKKDNPAAATVATKSAETAETSIAMPEFSTTEALTTRNTDEGCLGSTDSDSDSNSDGDDDDDFADDPEAVVYEHHSATGAELLARIRTALAMHPTTPFAEVRRFLEHNGSVIRHLVTMTVPHPDQYVMEPTTGALHEPAVRGAKKATASGGGCETPVAVAMLDWHSPLIDRHLANMVFYERERKTLRFREVMRKYRRGTHSRGAYRWLRAHSATSCIWDDEQRRARERRRRRRRLRVQHRGSWLVNEVRADGDEVMEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.54
4 0.48
5 0.39
6 0.34
7 0.26
8 0.23
9 0.19
10 0.16
11 0.15
12 0.13
13 0.14
14 0.12
15 0.12
16 0.13
17 0.13
18 0.12
19 0.11
20 0.09
21 0.08
22 0.08
23 0.08
24 0.09
25 0.08
26 0.09
27 0.1
28 0.11
29 0.12
30 0.14
31 0.14
32 0.16
33 0.17
34 0.16
35 0.16
36 0.16
37 0.16
38 0.14
39 0.13
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.1
47 0.11
48 0.11
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.07
56 0.08
57 0.08
58 0.07
59 0.08
60 0.07
61 0.06
62 0.05
63 0.05
64 0.05
65 0.04
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.1
74 0.08
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.05
82 0.05
83 0.06
84 0.07
85 0.11
86 0.12
87 0.12
88 0.13
89 0.14
90 0.14
91 0.15
92 0.14
93 0.12
94 0.14
95 0.15
96 0.17
97 0.21
98 0.21
99 0.21
100 0.25
101 0.23
102 0.22
103 0.22
104 0.2
105 0.15
106 0.16
107 0.15
108 0.1
109 0.1
110 0.08
111 0.06
112 0.07
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.09
121 0.12
122 0.1
123 0.1
124 0.1
125 0.1
126 0.11
127 0.1
128 0.09
129 0.05
130 0.05
131 0.06
132 0.07
133 0.08
134 0.11
135 0.11
136 0.12
137 0.12
138 0.14
139 0.14
140 0.14
141 0.13
142 0.14
143 0.14
144 0.15
145 0.16
146 0.14
147 0.13
148 0.12
149 0.11
150 0.07
151 0.07
152 0.05
153 0.03
154 0.03
155 0.04
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.1
164 0.13
165 0.13
166 0.14
167 0.19
168 0.19
169 0.19
170 0.2
171 0.17
172 0.14
173 0.14
174 0.2
175 0.16
176 0.22
177 0.26
178 0.28
179 0.36
180 0.43
181 0.49
182 0.5
183 0.55
184 0.59
185 0.66
186 0.73
187 0.73
188 0.73
189 0.69
190 0.71
191 0.75
192 0.71
193 0.68
194 0.68
195 0.69
196 0.68
197 0.66
198 0.64
199 0.6
200 0.6
201 0.58
202 0.52
203 0.46
204 0.4
205 0.42
206 0.37
207 0.36
208 0.31
209 0.29
210 0.27
211 0.25
212 0.25
213 0.26
214 0.27
215 0.32
216 0.4
217 0.42
218 0.48
219 0.55
220 0.64
221 0.69
222 0.78
223 0.79
224 0.82
225 0.88
226 0.92
227 0.94
228 0.96
229 0.97
230 0.97
231 0.97
232 0.95
233 0.92
234 0.89
235 0.85
236 0.75
237 0.67
238 0.62
239 0.55
240 0.48
241 0.4
242 0.33
243 0.27
244 0.26
245 0.24
246 0.18