Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MJY3

Protein Details
Accession A0A165MJY3   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-35APATKAKPARKAGKFTPKRTTKGKEFTPRAPRSHydrophilic
NLS Segment(s)
PositionSequence
7-32KAKPARKAGKFTPKRTTKGKEFTPRA
239-245KGPRPSR
276-282SRKKGKK
306-314GGGGKKKKR
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR026270  SRP72  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Amino Acid Sequences MSAPATKAKPARKAGKFTPKRTTKGKEFTPRAPRSTEDRLKRLFVSLTAQIDGAHFKNAIRTCNKILVLAPNDADVLQTKLFLLLQTEDYAAALDLASAPEHRFQKAYALYRLNRETDAGEVVKELKAVELDDDAARGVEHLEAQLEYRQGDYDGAVKTYTHLLDTCAPQSDEQSDLLTNLSAAQAHLDFLTSGFQSSIASLPATVIQSLETAPPPSAAPTASHPTTAVVTTSPAPTRKGPRPSRVPKGVVPGVTPPPDPERWIKKSERTNVVVHSRKKGKKVVGAAGTTQGAAVVEQPQPSAGGGGGGKKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.82
4 0.81
5 0.82
6 0.8
7 0.79
8 0.8
9 0.79
10 0.78
11 0.77
12 0.79
13 0.79
14 0.78
15 0.81
16 0.82
17 0.8
18 0.73
19 0.67
20 0.61
21 0.58
22 0.62
23 0.61
24 0.59
25 0.6
26 0.6
27 0.6
28 0.57
29 0.53
30 0.44
31 0.36
32 0.32
33 0.3
34 0.28
35 0.25
36 0.24
37 0.21
38 0.21
39 0.22
40 0.18
41 0.14
42 0.13
43 0.12
44 0.19
45 0.22
46 0.27
47 0.27
48 0.32
49 0.33
50 0.4
51 0.4
52 0.34
53 0.33
54 0.35
55 0.35
56 0.32
57 0.28
58 0.22
59 0.22
60 0.2
61 0.19
62 0.12
63 0.11
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.1
71 0.09
72 0.1
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.06
87 0.11
88 0.13
89 0.14
90 0.14
91 0.14
92 0.21
93 0.26
94 0.3
95 0.31
96 0.36
97 0.37
98 0.42
99 0.44
100 0.38
101 0.33
102 0.29
103 0.24
104 0.18
105 0.19
106 0.14
107 0.11
108 0.1
109 0.11
110 0.1
111 0.1
112 0.09
113 0.06
114 0.06
115 0.06
116 0.07
117 0.06
118 0.07
119 0.06
120 0.07
121 0.06
122 0.06
123 0.05
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.07
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.11
147 0.1
148 0.07
149 0.07
150 0.09
151 0.11
152 0.13
153 0.13
154 0.13
155 0.13
156 0.13
157 0.13
158 0.13
159 0.11
160 0.1
161 0.1
162 0.09
163 0.09
164 0.09
165 0.08
166 0.06
167 0.05
168 0.05
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.06
179 0.05
180 0.06
181 0.05
182 0.06
183 0.06
184 0.06
185 0.07
186 0.06
187 0.06
188 0.05
189 0.06
190 0.07
191 0.08
192 0.07
193 0.06
194 0.06
195 0.07
196 0.07
197 0.08
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.1
205 0.09
206 0.1
207 0.14
208 0.2
209 0.19
210 0.19
211 0.18
212 0.19
213 0.19
214 0.18
215 0.14
216 0.08
217 0.1
218 0.11
219 0.13
220 0.16
221 0.17
222 0.19
223 0.24
224 0.32
225 0.39
226 0.48
227 0.54
228 0.6
229 0.69
230 0.75
231 0.79
232 0.8
233 0.76
234 0.69
235 0.69
236 0.64
237 0.54
238 0.46
239 0.41
240 0.39
241 0.36
242 0.33
243 0.27
244 0.28
245 0.29
246 0.31
247 0.34
248 0.38
249 0.41
250 0.48
251 0.51
252 0.55
253 0.63
254 0.69
255 0.68
256 0.63
257 0.62
258 0.62
259 0.67
260 0.67
261 0.62
262 0.62
263 0.64
264 0.65
265 0.69
266 0.7
267 0.67
268 0.67
269 0.7
270 0.69
271 0.65
272 0.62
273 0.57
274 0.52
275 0.45
276 0.36
277 0.28
278 0.19
279 0.13
280 0.1
281 0.1
282 0.1
283 0.12
284 0.13
285 0.14
286 0.14
287 0.14
288 0.14
289 0.14
290 0.09
291 0.1
292 0.11
293 0.18
294 0.26