Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DBK5

Protein Details
Accession A0A165DBK5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-61LKRRAPRLPPGHRWRRVKKRAPGRARPHAPPBasic
NLS Segment(s)
PositionSequence
32-59KRRAPRLPPGHRWRRVKKRAPGRARPHA
Subcellular Location(s) mito 10, nucl 8, extr 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MAAATLPSTVAAPAQSAAQSGGCARSCVGALKRRAPRLPPGHRWRRVKKRAPGRARPHAPPQHPALSARLCRIASTSSNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.12
9 0.11
10 0.12
11 0.11
12 0.11
13 0.12
14 0.16
15 0.2
16 0.22
17 0.26
18 0.34
19 0.4
20 0.44
21 0.46
22 0.45
23 0.49
24 0.52
25 0.57
26 0.58
27 0.63
28 0.67
29 0.73
30 0.8
31 0.81
32 0.82
33 0.84
34 0.84
35 0.83
36 0.84
37 0.86
38 0.87
39 0.87
40 0.85
41 0.86
42 0.82
43 0.78
44 0.77
45 0.76
46 0.69
47 0.63
48 0.59
49 0.54
50 0.5
51 0.46
52 0.42
53 0.4
54 0.4
55 0.39
56 0.38
57 0.33
58 0.32
59 0.32
60 0.31