Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165J926

Protein Details
Accession A0A165J926    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPDRDLDSSRRRDPRRRTEINYSTRCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MPDRDLDSSRRRDPRRRTEINYSTRCSTTRDAPSSGLIPTTRSAKVQISRRQRHRYSGEVGGGGAGGSAAPQRRRARADVLLVRGYECSRGLGASVTVLVHRLGSRRREIATRRFVTKVATSVGLMSSWWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.84
4 0.82
5 0.83
6 0.84
7 0.85
8 0.81
9 0.74
10 0.67
11 0.6
12 0.54
13 0.48
14 0.42
15 0.4
16 0.42
17 0.41
18 0.39
19 0.38
20 0.39
21 0.36
22 0.32
23 0.26
24 0.17
25 0.15
26 0.14
27 0.17
28 0.16
29 0.15
30 0.17
31 0.21
32 0.27
33 0.34
34 0.41
35 0.48
36 0.57
37 0.66
38 0.73
39 0.7
40 0.72
41 0.68
42 0.64
43 0.57
44 0.52
45 0.44
46 0.34
47 0.31
48 0.23
49 0.18
50 0.13
51 0.08
52 0.04
53 0.02
54 0.02
55 0.04
56 0.06
57 0.07
58 0.15
59 0.18
60 0.22
61 0.25
62 0.28
63 0.32
64 0.33
65 0.4
66 0.37
67 0.38
68 0.36
69 0.33
70 0.31
71 0.26
72 0.22
73 0.17
74 0.12
75 0.1
76 0.08
77 0.08
78 0.08
79 0.08
80 0.08
81 0.06
82 0.07
83 0.06
84 0.06
85 0.07
86 0.06
87 0.07
88 0.08
89 0.12
90 0.18
91 0.23
92 0.28
93 0.31
94 0.33
95 0.41
96 0.47
97 0.52
98 0.57
99 0.56
100 0.56
101 0.54
102 0.52
103 0.49
104 0.45
105 0.39
106 0.31
107 0.28
108 0.24
109 0.23
110 0.23
111 0.18