Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ZIL4

Protein Details
Accession A0A165ZIL4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
110-139SITTDEPPRKKPKKSRKKGKKGANKARVAABasic
NLS Segment(s)
PositionSequence
117-136PRKKPKKSRKKGKKGANKAR
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MGHVQSQPLHDVPRTRSSFPQVAQALASGMGVPPPPLAPLRQSAKRKVDDVDESAQEPSMADPARDASMTLNSVPPSVSVPAPAVNDAMSADTSSAASAEPSLPVAAPASITTDEPPRKKPKKSRKKGKKGANKARVAAASPVPLPDPVIRSIAALASLRPSPAGVSGAHRTVALTLNTPAEVHKFLAAYLLHMPDVANLQIMCMVHLHQLNPETVATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.46
4 0.51
5 0.54
6 0.49
7 0.52
8 0.43
9 0.39
10 0.36
11 0.31
12 0.24
13 0.18
14 0.17
15 0.08
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.09
23 0.1
24 0.11
25 0.13
26 0.2
27 0.27
28 0.35
29 0.41
30 0.48
31 0.56
32 0.58
33 0.57
34 0.52
35 0.51
36 0.47
37 0.46
38 0.41
39 0.34
40 0.31
41 0.29
42 0.27
43 0.2
44 0.16
45 0.12
46 0.12
47 0.1
48 0.09
49 0.09
50 0.11
51 0.12
52 0.11
53 0.11
54 0.08
55 0.1
56 0.11
57 0.12
58 0.12
59 0.12
60 0.12
61 0.12
62 0.11
63 0.1
64 0.11
65 0.1
66 0.09
67 0.09
68 0.11
69 0.12
70 0.12
71 0.1
72 0.09
73 0.09
74 0.08
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.04
91 0.04
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.07
100 0.13
101 0.18
102 0.2
103 0.26
104 0.35
105 0.41
106 0.49
107 0.59
108 0.65
109 0.72
110 0.81
111 0.86
112 0.87
113 0.92
114 0.93
115 0.93
116 0.93
117 0.93
118 0.93
119 0.91
120 0.84
121 0.73
122 0.67
123 0.57
124 0.48
125 0.39
126 0.29
127 0.21
128 0.17
129 0.16
130 0.13
131 0.12
132 0.12
133 0.11
134 0.13
135 0.12
136 0.14
137 0.13
138 0.13
139 0.13
140 0.11
141 0.11
142 0.09
143 0.08
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.08
150 0.09
151 0.1
152 0.09
153 0.13
154 0.16
155 0.17
156 0.17
157 0.17
158 0.16
159 0.16
160 0.19
161 0.15
162 0.14
163 0.14
164 0.15
165 0.15
166 0.15
167 0.14
168 0.14
169 0.15
170 0.14
171 0.14
172 0.13
173 0.13
174 0.17
175 0.16
176 0.15
177 0.17
178 0.17
179 0.15
180 0.15
181 0.16
182 0.12
183 0.14
184 0.12
185 0.11
186 0.1
187 0.1
188 0.12
189 0.12
190 0.12
191 0.1
192 0.11
193 0.14
194 0.16
195 0.17
196 0.18
197 0.21
198 0.21
199 0.22