Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LRG3

Protein Details
Accession A0A165LRG3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-123PLQVAKPHNARPHKRKRVRSPKEESDISHydrophilic
NLS Segment(s)
PositionSequence
49-73PRKPRSLPTKPRTPTSSPRAKRTRH
102-117PHNARPHKRKRVRSPK
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MSVPLTPPSTPRRSARLAEKEKNTNSSPGVAIAIGIVSRAQAQAPSTPPRKPRSLPTKPRTPTSSPRAKRTRHGPVKEEVGVVLVQARTLRYVTPPLQVAKPHNARPHKRKRVRSPKEESDISPLMDSPFLARPGRDGLRKARNDLVQRMLSASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.62
4 0.66
5 0.69
6 0.72
7 0.74
8 0.71
9 0.71
10 0.62
11 0.55
12 0.47
13 0.41
14 0.34
15 0.26
16 0.23
17 0.16
18 0.14
19 0.1
20 0.09
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.06
29 0.07
30 0.11
31 0.15
32 0.22
33 0.25
34 0.3
35 0.36
36 0.41
37 0.45
38 0.45
39 0.51
40 0.54
41 0.62
42 0.68
43 0.68
44 0.74
45 0.7
46 0.73
47 0.69
48 0.64
49 0.61
50 0.59
51 0.63
52 0.56
53 0.63
54 0.66
55 0.63
56 0.63
57 0.63
58 0.65
59 0.64
60 0.65
61 0.59
62 0.54
63 0.56
64 0.5
65 0.41
66 0.3
67 0.21
68 0.16
69 0.13
70 0.11
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.07
79 0.13
80 0.14
81 0.16
82 0.18
83 0.2
84 0.21
85 0.24
86 0.26
87 0.31
88 0.35
89 0.38
90 0.44
91 0.51
92 0.59
93 0.66
94 0.74
95 0.76
96 0.8
97 0.85
98 0.89
99 0.91
100 0.92
101 0.91
102 0.89
103 0.87
104 0.85
105 0.78
106 0.68
107 0.64
108 0.55
109 0.46
110 0.37
111 0.28
112 0.21
113 0.19
114 0.17
115 0.12
116 0.14
117 0.17
118 0.17
119 0.17
120 0.18
121 0.25
122 0.31
123 0.33
124 0.34
125 0.4
126 0.49
127 0.53
128 0.55
129 0.56
130 0.58
131 0.6
132 0.61
133 0.59
134 0.51
135 0.48