Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MQ66

Protein Details
Accession A0A165MQ66    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-108PSSPLHTRLRRRLPPRTPTPCGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MPLGRRVCALAHSTTLNSMGSRLTSSPVLTQLKTIYPVAHAMAVEEVRLSPFPVSVCSWFDVIPPVAARSARGEESRLPAPPGPTAPSSPLHTRLRRRLPPRTPTPCGTVAAPSFVGPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.18
4 0.15
5 0.13
6 0.11
7 0.1
8 0.11
9 0.11
10 0.12
11 0.12
12 0.13
13 0.14
14 0.2
15 0.22
16 0.21
17 0.22
18 0.21
19 0.21
20 0.23
21 0.22
22 0.15
23 0.13
24 0.15
25 0.14
26 0.13
27 0.11
28 0.09
29 0.1
30 0.09
31 0.08
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.05
38 0.06
39 0.06
40 0.08
41 0.09
42 0.1
43 0.11
44 0.12
45 0.12
46 0.12
47 0.12
48 0.12
49 0.1
50 0.1
51 0.08
52 0.08
53 0.09
54 0.08
55 0.09
56 0.1
57 0.12
58 0.13
59 0.13
60 0.15
61 0.16
62 0.2
63 0.21
64 0.2
65 0.2
66 0.2
67 0.2
68 0.2
69 0.2
70 0.19
71 0.19
72 0.19
73 0.2
74 0.21
75 0.24
76 0.26
77 0.32
78 0.38
79 0.43
80 0.51
81 0.58
82 0.66
83 0.71
84 0.75
85 0.78
86 0.8
87 0.82
88 0.84
89 0.83
90 0.79
91 0.73
92 0.71
93 0.63
94 0.55
95 0.47
96 0.42
97 0.34
98 0.3
99 0.27