Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165H7D4

Protein Details
Accession A0A165H7D4   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
303-325ETPEPTTTSKPTCKKHRRSRRSHBasic
NLS Segment(s)
PositionSequence
317-324KHRRSRRS
Subcellular Location(s) extr 16, cyto 6, nucl 2, mito 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009939  Chitosanase_fungal  
Gene Ontology GO:0005576  C:extracellular region  
GO:0016977  F:chitosanase activity  
GO:0000272  P:polysaccharide catabolic process  
Pfam View protein in Pfam  
PF02389  Cornifin  
PF07335  Glyco_hydro_75  
Amino Acid Sequences MPSALALSIYLSLAGSAFAAANFTRRADGSAFQADSSIDVDALYNAVKSASAAKKNVLATYPTCNDCDGASDVDLIGDWKDLPGLDGTFSFMADMDVDCDGVAWQCPGNPDGQSETSFGKMDSTQAPWYVIPEKFFSNGGLKPNALGAIICNGKMFYGVFADSNGDSPQVIGEGSLILAQTCFPDDGMSGANGHPTPDVAYIVFANEVPDGVGEETLDYDSLKQLGDKKARELLSALDLGSDPGSGGGEDPSSTEAPEPSSTETPEPSSTETSEPTETAEPSSTESESPEPTETETPEPTETETPEPTTTSKPTCKKHRRSRRSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.07
7 0.07
8 0.1
9 0.12
10 0.12
11 0.14
12 0.14
13 0.17
14 0.17
15 0.19
16 0.22
17 0.27
18 0.26
19 0.24
20 0.25
21 0.22
22 0.2
23 0.19
24 0.14
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.07
31 0.06
32 0.05
33 0.06
34 0.05
35 0.06
36 0.14
37 0.21
38 0.26
39 0.27
40 0.29
41 0.34
42 0.36
43 0.37
44 0.31
45 0.27
46 0.24
47 0.3
48 0.33
49 0.29
50 0.28
51 0.27
52 0.26
53 0.22
54 0.23
55 0.18
56 0.15
57 0.14
58 0.13
59 0.12
60 0.12
61 0.11
62 0.08
63 0.07
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.07
72 0.07
73 0.08
74 0.1
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.05
86 0.06
87 0.05
88 0.05
89 0.06
90 0.05
91 0.05
92 0.06
93 0.08
94 0.08
95 0.09
96 0.1
97 0.11
98 0.14
99 0.15
100 0.15
101 0.16
102 0.17
103 0.16
104 0.16
105 0.15
106 0.13
107 0.11
108 0.12
109 0.12
110 0.14
111 0.14
112 0.14
113 0.15
114 0.14
115 0.16
116 0.18
117 0.17
118 0.16
119 0.17
120 0.17
121 0.17
122 0.17
123 0.17
124 0.16
125 0.17
126 0.19
127 0.18
128 0.17
129 0.16
130 0.16
131 0.15
132 0.11
133 0.08
134 0.06
135 0.08
136 0.09
137 0.08
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.04
144 0.05
145 0.05
146 0.05
147 0.06
148 0.07
149 0.07
150 0.08
151 0.07
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.03
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.06
175 0.06
176 0.06
177 0.06
178 0.08
179 0.08
180 0.09
181 0.07
182 0.07
183 0.08
184 0.08
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.08
191 0.06
192 0.06
193 0.06
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.07
211 0.13
212 0.21
213 0.28
214 0.29
215 0.32
216 0.38
217 0.38
218 0.37
219 0.32
220 0.26
221 0.23
222 0.22
223 0.18
224 0.12
225 0.12
226 0.11
227 0.1
228 0.08
229 0.05
230 0.05
231 0.05
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.09
239 0.09
240 0.09
241 0.1
242 0.1
243 0.12
244 0.14
245 0.15
246 0.17
247 0.19
248 0.2
249 0.21
250 0.23
251 0.23
252 0.24
253 0.24
254 0.22
255 0.23
256 0.23
257 0.23
258 0.24
259 0.24
260 0.23
261 0.22
262 0.22
263 0.21
264 0.2
265 0.2
266 0.19
267 0.16
268 0.18
269 0.2
270 0.18
271 0.16
272 0.18
273 0.19
274 0.2
275 0.22
276 0.2
277 0.19
278 0.21
279 0.24
280 0.24
281 0.26
282 0.26
283 0.26
284 0.26
285 0.26
286 0.26
287 0.26
288 0.26
289 0.26
290 0.27
291 0.27
292 0.27
293 0.28
294 0.27
295 0.29
296 0.32
297 0.35
298 0.42
299 0.48
300 0.56
301 0.66
302 0.74
303 0.8
304 0.86
305 0.9